cenovnik medicina, M Frotscher, W Kahle, M Frotscher, W Platzer

Tags: International Edition, Frank H. Netter, Interventional Radiology, Human Anatomy, Oxford Handbook, Atlas of Human Anatomy, Musculoskeletal System, Anatomy and Physiology, Color Atlas, Pediatric Cardiology, Michael Frotscher, Atlas of Anatomy, Heart Disease, Orthopaedic Clinical Examination, Diagnostic Imaging, Musculoskeletal Radiology, Congenital Heart Disease, Mayo Clinic Cardiology, Mark Feldman, Orthopaedics, Corbridge, Rogan, Albert F. Simon, Ed Buckup, Fred F. Ferri, LKVLPSWRPD John H. Wasson kod odraslih, Current Diagnosis, Oliver Surgery, Tao Le, Timothy Leung, Oral and Maxillofacial Surgery, Peter G. Bullough, Neck Surgery Corbridge, Expert Thomas J. Errico, Samuel C. Matheny, First Tao Le, David L. Felten Jennifer Hart Jon C. Thompson Michael, American Medical Association Guide, Nuclear Medicine, Congenital Heart Defects, Peripheral Arterial Disease, Endovascular Surgery Hallett, ESC Textbook of Cardiovascular Medicine, Principles, Patric Robert H. Anderson, Echocardiography Leeson, Clinical Applications, Practice of Clinical Echocardiography, Udo Schumacher Kyung Won Chung, Emil SNELL Anne Waugh Trent D. Stephens, Human Anatomy and Physiology, Werner Platzer, Michael Sch�nke, Textbook of Interventional Cardiology, Developmental Anatomy, IE Drake Frank H. Netter, Robert E. Hunter, Ronald Mcrae, Medical Genetics, Neville Hacker Gynecology, Conceptual Thomas J. Dewitt, Gastrointestinal System, Human Molecular Genetics, Peter L. Munk, Ed David M. Yousem, Differential Diagnosis, Abass Alavi Frank L. Quattromani Karl J. Wolf, Peter Reimer, Gastrointestinal Pathology, Medical Genetics Young, Liver Diseases, Liver Disease, William Klug Michael Cummings Charlotte Spencer, William Outline Series, Colorectal Surgery, Obstetrics and Gynaecology, Surgical Techniques, Anthony S. Fauci, Robert Hawes, Matthias Hofer Richard Gunderman, Emergency Medicine, David Magee, Cardiovascular Imaging, Walter Heindel Val M. Runge, Anthony G. Ryan Alexander R. Vaccaro, Ed Whitney Lowe, Ed Kaschke, Orthopaedic Pathology, David L. Hamblen, Oxford Textbook of Medicine, Vikas Bhushan, Medical Imaging, Clinical Medicine Alexander Levitov, Pediatric Radiology, Atlas of Brain Function, Aunt Minnie's Atlas and Imaging-Specific Diagnosis, David M. Yousem, Sports Medicine, Functional Magnetic Resonance Imaging, Clinical Medicine, Clinical Radiology Graham, Emergency Ultrasound, John Herring
Content: cenovnik medicina
sifra
naslov
autori
alergologija
5253 *sp* Atlas of Allergic Diseases
Lieberman
8546 Color Atlas of Allergic Diseases
Martin Roecken
36522 Oxford Handbook of Clinical Immunology and Allergy Spickett, Gavin (2/e)
47316 Quantitative Skin Testing for Allergy: IDT and MQT
55716 Atopijske bolesti
%RJLь0LUMDQD
71813 Middleton's Allergy: Principles and Practice,
N. Franklin Adkinson
73095 PATTERSONS ALLERGIC DISEASES 7E CB
GRAMMER
111839 Pediatric Allergy,2ed
Donald Y. M. Leung
117713 Alergijske i imunoloske bolesti
-/LSR]HQюLьLVXUDGQLFL
118503 Alergijske bolesti
9HVHOLQ.LNLQяDQLQ
anatomija
5333 COLOUR ATLAS AND TEXTBOOK OF HUMAN ANATOMY (V. 3) : NERVOUS SYSTEM AND SENSORY ORGANS 5 Rev ed
Frotscher, Michael; Kahle, Werner; Frotscher, Mich
6896 COLOR ATLAS AND TEXTBOOK OF HUMAN
Platzer, Werner; Meyer,
ANATOMY (VOL 1) : LOCOMOTOR SYSTEM, 5 Ed David B.
14576 Nervous System: Anatomy and Physiology (Netter Collection of Medical Illustrations, Volume 1, Part 1)
Frank H. Netter
14585 Musculoskeletal System: Anatomy, Physiology, Metabolic Disorders (Netter Collection of Medical Illustrations, Volume 8, Part 1)
Frank H. Netter
19613 35,58э1,$1$7206.,$7/$6±VXVWDYRUJDQD]D Werner Platzer, ur. hrv. izd.
SRNUHWDQMHFMHORNXSQRSUHUDяHQRL]GDQMH
Ivan Vinter
19614 $1$7206.,$7/$68752%1,25*$1,3ULUXюQLN W. Kahle, H. Leonhardt, W.
]DVWXGHQWHLOLMHюQLNH
Platzer
urednici hrv.
26081 MEMMLERS HUMAN BODY HEALTH DIS 1,IE
COHEN
30566 Anatomy and Physiology
Saladin, Ken
30567 Laboratory Atlas of Anatomy and Physiology
Bertram, John W.
31307 Anatomija treninga snage
Frederic Delavier
31526 ANATOMSKI ATLAS 2 Unutarnji organi
Helga Fritsch i Wolfgang Kuhnel
31527 $1$7206.,$7/$6дLYюDQLVXVWDYLRVMHWLOD
Werner Kahledopunio Michael Frotscher
34755 Atlas of Human Anatomy, International Edition, 4th Edition
Netter
27.04.2011
god cena(din)
2002 2003 2006
5270.00 1939.00 2875.00
2006 2000 2008 2009 2010 2010 2010
3235.00 1038.00 23790.00 11346.00 9881.00 5180.00 1296.00
2002 3775.00
2003 3775.00 2000 6460.00 1999 6460.00
2003 2800.00 1990 1960.00
2005 2006 2005 2007 2006
1922.00 5245.00 3659.00 2295.00 2800.00
2006 2800.00
2006 3373.00
35533 POCKET ATLAS OF SECTIONAL ANATOMY : COMPUTED TOMOGRAPHY AND MAGNETIC
Moeller, Torsten Bert; Reif, Emil
2006 3775.00 1 od 116
RESONANCE IMAGING (V. 1) : HEAD AND NECK 3 Rev ed 35535 Pocket Atlas of Sectional Anatomy: Computed Tomography and Magnetic Resonance Imaging Volume 2: Thorax, Abdomen, and Pelvis, 3 rev. ed
Moeller, Torsten Bert; Reif, Emil
35536 POCKET ATLAS OF SECTIONAL ANATOMY : COMPUTED TOMOGRAPHY AND MAGNETIC RESONANCE IMAGING (V. 3) : COMPUTED TOMOGRAPHY AND MAGNETIC RESONANCE IMAGING 36058 CLINICAL ANATOMY BY SYSTEMS 36164 Ross and Wilson's Anatomy and Physiology Colouring and Workbook, 2nd edition 36701 Essentials of Anatomy and Physiology 36734 Hole's Human Anatomy and Physiology 36803 Anatomy and Physiology: With OLC Bind-in Card 37961 Anatomija i fiziologija 40210 Netter's Head and Neck Anatomy for Dentistry 43472 Gray's Dissection Guide for Human Anatomy, 2nd edition 47349 Atlas of Anatomy. Head and Neuroanatomy (Thieme Atlas of Anatomy) 47403 BRS Gross Anatomy, 6 Ed 47575 Elsevier's Integrated Anatomy and Embryology 47697 McMinn's Clinical Atlas of Human Anatomy, International Edition, 6th edition
Moeller, Torsten Bert; Reif, Emil SNELL Anne Waugh Trent D. Stephens, Rod R. Seeley, Philip Tate David N. Shier, Jackie L Butler, Ricki Lewis Rod R. Seeley, Trent D. Stephens, Philip Tate Predrag Keros, Branka 0DWNRYLь Neil Norton David Morton Michael Schьnke, Erik Schulte, Udo Schumacher Kyung Won Chung, Harold M. Chung Bruce Bogart Abrahams
48406 Gray's Atlas of Anatomy 49152 Atlas of Human Anatomy: With Netteranatomy.com, 4 Ed 49873 7HPHOMLDQDWRPLMHюRYMHNDVWU 49879 .OLQLюNDDQDWRPLMDDEGRPHQDVWU 49939 Funkcijska anatomija lokomotornog sustava, 600 str. 50144 $WODVDQDWRPLMHюRYHND1HWWHUL]GDQMH 52054 Lippincott Williams & Wilkins Atlas of Anatomy 55092 $WODVGLVHNFLMHюRYHND 55093 Human Anatomy 5th IE
Drake Frank H. Netter Predrag Keros, Marko 3HьLQD Frank H. Netter 0LODQ0LOLVDYOMHYLьL saradnici Gosling
55126 $QDWRPLMDюRYHNDJODYDLYUDW]DVWXGHQWHPHGLFLQH 55138 Netter's Concise Radiologic Anatomy, 55362 Color Atlas and Textbook of Human Anatomy: Color Atlas and Textbook of Human Anatomy 2. Internal Organs: Bd 2 (Thieme Flexible Taschenbьcher) 56131 Rapid Review Gross and Developmental Anatomy: With STUDENT CONSULT Online Access (Rapid Review) 59986 Surface Anatomy,
-RYDQRYLь6ODYROMXE9 autor Edward Weber Helga Fritsch, Wolfgang Kuehnel N. Anthony Moore, William A. Roy John Lumley
2006 3775.00 2006 3775.00
2006 4331.00 2006 2317.00 2006 3952.00 2006 5245.00 2005 4879.00 2006 1400.00 2006 3781.00 2006 4025.00 2007 6475.00 2007 2440.00 2007 3049.00 2007 3141.00
2007 3961.00 2006 6343.00
2007
3255.00 2796.00 5903.00
2007 2008 2011
7445.00 4819.00 2000.00
2008 3415.00
2006 702.00
2008 4513.00 2007 3775.00
2007 3171.00
2008 2683.00 2 od 116
59986 Surface Anatomy, 60043 Clinical Tests for the Musculoskeletal System, 2 Ed 60304 Gray's Anatomy for Students 2nd IE: With STUDENT CONSULT Online Access
John Lumley Buckup Drake
2008 2008 2009
2683.00 4315.00 3825.00
60307 Gray's Anatomy 40th: The Anatomical Basis of Clinical Strandring Practice, Expert Consult - Online and Print-IE
61349 Surface Anatomy: The Anatomical Basis of Clinical Examination IE
John Lumley
63674 Sobotta Atlas of Human Anatomy
Putz
65049 Case Files: Gross Anatomy IE edition(Lange Case Files)
Eugene C. Toy, Lawrence M. Ross, Leonard J. Cleary
65530 Atlas of Anatomy
Anne M. Gilroy, Lawrence M. Ross, Brian R. MacPher
65812 Atlas palpatorne anatomije
Serge Tixa
65976 Opsta patoloska anatomija
2SULь0LURVODYDXWRU
65977 Specijalna patoloska anatomija
2SULь0LURVODYDXWRU
66632 $QDWRPLMDюRYHNDSULUXюQLN]DSUDNWLюQXQDVWDYX
9HUD'UDJDQLь1DGHеGD -HOLюLь/-XELFDRUяHYLь9LG
66633 $QDWRPLMDюRYHNDDEGRPHQLNDUOLFD
0LMDю0LUMDQDDXWRU
66634 Anatomija grudnog kosa : (thorax)
%RJGDQRYLь'UDJRVODY autor
66635 Anatomija gornjeg ekstremiteta : [membrum superius] ,OLь$OHNVDQGDUDXWRU
66636 $QDWRPLMDюRYHNDJODYDLYUDW]DVWXGHQWHPHGLFLQH -RYDQRYLь6ODYROMXE9 autor
66637 Anatomija donjeg ekstremiteta : [membrum inferius] 0UYDOMHYLь'UDJDQDXWRU
66638 Anatomija centralnog nervnog sistema
$OHNVDQGDU,OLь0LOHQD %ODJRWLь6ORERGDQ 0DOREDELь
66639 0RеGDQLLNLюPHQLеLYFLLOXVWURYDQLNRPSHQGLMXP
9HUD'UDJDQLь5DGPLOD *XGRYLь=GHQND .ULYRNXьD/DV
67757 $QDWRPLMDюRYHNDGHVNULSWLYQDLIXQNFLRQDOQD
%RгNRYLь0DUMDQ6DXWRU
67758 Anatomski atlas : za studente medicine i stomatologije Slavoljub -RYDQRYLь0RPюLOR '-RUGMHYLь1DGHеGD-H
68259 Lower Limb Anatomy, Palpation & Surface Markings, Derek Field
68261 Anatomy and Human Movement Study Cards,
Nigel Palastanga
68916 Oral Anatomy, Histology & Embryology 4thed -IE
Berkowitz
2008 8334.00
2008 1502.00
2008 5464.00 2008 1707.00
2008 7555.00
2009 2008 2008 2007
1980.00 1620.00 2268.00 2484.00
2008 1080.00 2008 567.00
2008 2008
459.00 783.00
2006 2007
486.00 648.00
2006 486.00
2005 972.00 2007 1512.00
2008 2008 2009
3415.00 2927.00 3825.00
69013 CLINICALLY ORIENTED ANATOMY 6E - IE 69031 Imaging Atlas of Human Anatomy 4th
MOORE Weir
2009 3904.00 2009 2048.00
70096 Funkcionalna i topografska neuroanatomija
0DULQNRYLь6ORERGDQ autor
70784 Human Anatomy and Physiology:International Edition Elaine Marieb Katja Hoehn 8ed
70788 Essentials of Anatomy & Physiology:International Editio Frederic Martini Edwin
5ed
Bartholomew
71061 Gray's Anatomy for Students Flash Cards, 2nd Edition Richard Drake
1998 1620.00 2009 5489.00 2009 4315.00 2009 2927.00
71304 Gray's Anatomy Review
Loukas
2009 2322.00
71634 Mosby's Anatomy & Physiology Study and Review Cards, 71823 Anatomy Trains, 2nd Edition
Mosby Thomas W. Myers
2009 2317.00 2008 4025.00 3 od 116
71856 Netter's Anatomy Coloring Book with Student Consult Access
John T. Hansen
71859 Sobotta - Atlas of Human Anatomy English/Latin Single Reinhard Putz Volume Edition, 14th Edition
71868 $QDWRPLMDюRYHNDJODYDLYUDW 72386 Anatomy Flash Cards 72387 Color Atlas of Human Anatomy, Vol 1: Locomotor System, 6 Ed 72476 Atlas of Brain Function 73239 GRANTS ATLAS OF ANATOMY 12E (INT ED) PB 74395 $QDWRPLMDюRYHNDRVWHRORJLMD]DVWXGHQWHPHGLFLQH
76117 Anatomija istezanja
76897 Grantov anatomski atlas 77911 Netter's Neuroscience Flash Cards, 77913 Netter's Musculoskeletal Flash Cards, 77921 Netter's Concise Orthopaedic Anatomy, 78785 Head and Neck Anatomy for Dental Medicine
79370 Netter's Clinical Anatomy,
80110 Clinical Anatomy 12e
81982 HIGH-YIELD GROSS ANATOMY 4E
PB
81983 ESSENTIAL CLINICAL ANATOMY 4E INT ED PB
82487 Ross and Wilson Anatomy and Physiology in Health and Illness International Edition, 11th Edition
82774 COLOR ATLAS OF ANATOMY 7E ( INT ED ) CB
109327 Atlas of Human Anatomy 5th-IE
8QNRYLь6WRMDQNDDXWRU Anne M. Gilroy Werner Platzer William W. Orrison AGUR 0LMDю0LUMDQD%ODJRWLь 0LOHQDRUяHYLь/-XELFD Arnold G. Nelson, Jouko Kokkonen Agur, En M. R. - autor David L. Felten Jennifer Hart Jon C. Thompson Michael Schьnke, Erik Schulte, Udo Schumacher John T. Hansen Ellis H DUDEK MOORE Waugh & Grant ROHEN Netter
109409 CLINICAL ANATOMY FOR YOUR POCKET SP GOULD
110096 Netter's Anatomy Flash Cards,
John T. Hansen
110097 Atlas of Human Anatomy,with Student Consult Access , Frank H. Netter 5th Edition
111742 Rapid Review Gross and Developmental Anatomy,3ed N. Anthony Moore
112268 Anatomy at a Glance
Sibani Mazumdar
112706 Color Atlas and Textbook of Human Anatomy: Color Atlas of Human Anatomy 3: Nervous System and Sensory Organs
Werner Kahle, Michael Frotscher
112720 Cranial Nerves: Anatomy, Pathology, Imaging
Devin K. Binder
112722 Schьnke, Michael; Schulte, Erik; Schumacher, Udo : General Anatomy and Musculoskeletal System (Thieme Atlas of Anatomy)
Michael Schьnke, Erik Schulte, Udo Schumacher
114322 LWW ILLUS Q&A REV ANATOMY EMBRYOLOGY PB
LAMBERT
114777 Schaum's Outline of Human Anatomy and Physiology Van de Graaf
115060 The Netter Collection of Medical Illustrations: The Endocrine System,2
William F. Young
115227 Atlas anatomije - Gilroy
Anne M. Gilroy, Brian R. MacPherson, Lawrence M. R
116018 Netter's Neuroscience Flash Cards,
David L. Felten
2009 1585.00
2009 13420.00
2003 2008 2008
1512.00 3235.00 3775.00
2008 2009 2008
7555.00 4392.00 675.00
2009 985.00
2009 2004 2007 2009 2010
7020.00 2927.00 2927.00 4391.00 6475.00
2009 2010 2010 2010 2010
4391.00 4269.00 1829.00 3293.00 1707.00
2010 5490.00 2010 3319.00
2008 2010 2010
1829.00 2927.00 5899.00
2010 2010 2010
3171.00 5977.00 4315.00
2010 8635.00 2010 6475.00
2010 3410.00 2009 1463.00 2010 7807.00 2010 5999.00
2010 2927.00 4 od 116
116018 Netter's Neuroscience Flash Cards,
David L. Felten
116739 $QDWRPLMDRNDVDSULORJRP]DDQDWRPLMXL]SRGUXюMD 3DMLь'XгDQDXWRU
neurooftalmologije
L]GDYDю
116962 Atlas anatomije - Gilroy (sa online pristupom)
Anne M. Gilroy, Brian R. MacPherson, Lawrence M. R
117227 MANUAL OF HAND ANATOMY
PB
BOYER
117561 The Netter Collection of Medical Illustrations: Respiratory System,3
David Kaminsky
117562 The Netter Collection of Medical Illustrations: Reproductive System,1
Roger P. Smith
118462 $QDWRPLMDюRYMHND±)RWRJUDIVNLDWODVVXVWDYQHL
Rohen, J. W. (ur.), Yokochi,
WRSRJUDIVNHDQDWRPLMHGRUDяHQRLSURгLUHQRL]GDQMH C. i Lutjen-Drecoll,
118482 Anatomija preseka i arterije mozga
0LOLVDYOMHYLь0LODQDXWRU
119183 Anatomija treninga snage, 5. izdanje
Frederic Delavier
anesteziologija
8742 Wylie & Churchill-Davidson's a Practice of Anesthesia Healy 7th Edition
12479 *sp* Handbook of Local Anesthesia, 5th edition
Stanley Malamed
16911 Evidence Based Resource in Anaesthesia and Analgesia - IE
Tramer, Martin (Geneva University Hospital, Switze
18017 *sp* Peripheral Nerve Blocks: Principles and Practice Admir HadziciJerry Vloka
24929 The Physics, Clinical Measurement and Equipment of Patrick MageeiMark Tooley Anaesthetic Practice
26064 Lee's Synopsis of Anaesthesia 13th ,IE
Davies
2010 2927.00 2007 2700.00 2010 6999.00
2010 5490.00 2011 7807.00
2010 7807.00
2009 8085.00
2006 2011
864.00 0.00
2003 23790.00 2004 4782.00 2003 2745.00 2004 4758.00 2005 4370.00 2005 2595.00
36647 Clinical Anesthesiology, 4 Ed - ISE
Edward Morgan, Maged S. Mikhail,Michael Murray
37817 EXCERPTA ANAESTHESIOLOGICA REANIMATOLOGICA ET ALGOLOGICA
Vjenceslav Kiseljak
47308 Peripheral Regional Anesthesia, with DVD-ROM
Gisela Meier, Johannes Bьttner
47387 HARVARD MANUAL OF OFFICE-BASED ANESTHESIA PROCEDURES
SHAPIRO
47408 Complications in Anesthesiology
Nikolaus Gravenstein, Emilio B. Lobato, Robert R.
48392 Decision Making in Anesthesiology, 4th edition
Lois Bready
49477 Obstetric Anesthesia
Pian-Smith/Leffler
49862 *sp* PAIN UPDATED : MECHANISMS AND EFFECTS Mathur, Rashmi
49941 Lokalna i provodna anestezija, 152 str.
52025 Pain Management, 2nd edition
Chris Main
53853 Intenzivna medicina
0DUNR-XNLь
53892 Anesthesiology
David Longnecker, David Brown, Mark Newman
55168 Stoelting's Anesthesia and Co-Existing Disease,
Roberta Hines
60396 Meyler's Side Effects of Drugs Used in Anesthesia (Meylers Side Effects) (Meylers Side Effects)
Jeffrey K. Aronson
61070 Obstetric Anaesthesia
Clyburn, Paul; Collis, Rachel; Harries, Sarah; Dav
61701 5HJLRQDOQDDQHVWH]LMDLQMHQDSULPHQDXOHюHQMXERODL -RYDQRYLь-RYDQDXWRU bolnih stanja
64308 Regionalna nervna blokada i infiltraciona terapija bola -DQNRYLь'DQLOR0DXWRU
64341 2VQRYLGHюMHDQHVWH]LRORJLMH
6LPLь'XгLFD0DXWRU
66250 Miller's Anesthesia International Edition 2 Volume Set, Miller 7th Edition
2005 2995.00
1998 1120.00
2007 12955.00
2007 2989.00
2007 10736.00
2007 2007 2006 2007 2008 2008
10735.00 3660.00 2440.00 2219.00 5611.00 13300.00 20739.00
2008 11833.00 2008 4879.00
2008 5371.00
2007 1080.00
2004 4860.00 2005 756.00 2009 17490.00
5 od 116
66422 Fundamentals of Anaesthesia
68935 CLINICAL ANESTHESIA 6E
CB
71569 Pain Management Secrets, 3rd Edition
71581 Obstetric, Thoracic and Cardiac Anesthesia,
71786 Anaesthesia and Intensive Care A-Z, 4th Edition-An Encyclopedia of Principles and Practice
Smith et al BARASH Argoff & McCleane Robert R. Gaiser Steven M. Yentis
2009 2009 2009 2009 2009
9150.00 16226.00 4025.00 5855.00 9027.00
72389 Spinal Injection Techniques
Theodoros Theodoridis, Jьrgen Krдmer
74171 Oxford Handbook of Anaesthesia Book and PDA Pack Allman, Keith; Wilson, Iain
74223 Oxford Handbook of Anaesthesia and Emergencies in Allman, Keith; McIndoe,
Anaesthesia Pack (2/e)
Andrew; Wilson, Iain
74225 Emergencies in Anaesthesia (2/e)
Allman, Keith; McIndoe, Andrew; Wilson, Iain
74685 McGraw-Hill Specialty Board Review Pain Medicine
Salahadin Abdi, Pradeep Chopra, Howard Smith
74687 WESTMEAD MANUAL OF ANAESTHETICS
Anthony Padley
74688 Anaesthesia in Laparoscopic Surgery
Jayashree Sood, Anil Kumar Jain
75483 Principles of Physiology for the Anaesthetist 2e
Ian Power
79725 Johns Hopkins Anesthesiology Handbook,
Eugenie S. Heitmiller
80965 The Clinical Anaesthesia Viva Book
Barker et al
81094 Oxford Handbook of Anaesthesia for PDAs (2/e)
Allman, Keith; Wilson, Iain
81207 Manual of Pediatric Anesthesia,
Jerrold Lerman
81879 Anesthesia: a Comprehensive Review,
Brian A. Hall
82064 Clinical Manual and Review of Transesophageal Echocardiography
Mathew
82396 Anesthesia Secrets,4 ed
James Duke
82416 Pediatric Anesthesiology Review: Clinical Cases for Self-Assessment
Robert Holzman, Thomas J. Mancuso, Navil F. Sethna
109995 Cardiac Anaesthesia
Barnard, Matthew; Martin, Bruce
110098 Local and Regional Anaesthesia in the Emergency Department Made Easy International Edition,
Mike Wells
111628 Atlas of Regional Anesthesia,4ed
David L. Brown
111739 Essence of Anesthesia Practice,
Lee A. Fleisher
111740 Examination Anaesthesia,2ed
Christopher Thomas
112486 First Aid for the Anesthesiology Boards (First Aid Specialty Boards)
Himani Bhatt, Karlyn J. Powell, Dominique Aimee Je
112659 Anaesthesiology (Churchill's Ready Reference)
Michael (Monty) Mythen
113934 Ultrasound Guidance in Regional Anaesthesia (2/e) Marhofer, Peter
114224 POCKET ANESTHESIA
PB
URMAN
114225 REVIEW OF CLINICAL ANESTHESIA 5E PB
CONNELLY
114489 Local and Regional Anaesthesia in the Emergency Department Made Easy,
Mike Wells
114831 Anesthesia Emergencies
Ruskin, Keith; Rosenbaum, Stanley
114832 Practical Procedures in Anaesthesia and Critical Care Jackson, Guy; Soni, Neil; Whiten, Christopher J.
115014 Anestezija u traumi
3RSRSYLь1DGD
115352 %2/X]URFLLOLMHюHQMH
0-XNLь90DMHULь.RJOHU
2009 15115.00
2007 5969.00 2009 5621.00
2009 2745.00
2009 4147.00
2009 4147.00 2009 11589.00
2007 2009 2009 2007 2010 2010 2010
5489.00 4147.00 4270.00 3501.00 5855.00 6709.00 12199.00
2010 4025.00 2010 8961.00
2010 4996.00
2010 975.00
2010 2010 2010 2010
14152.00 6099.00 4757.00 6343.00
2010 2010 2009 2009 2010
2439.00 4996.00 3654.00 4874.00 2683.00
2010 4064.00
2010 4370.00
2010 9280.00 2010 4200.00 6 od 116
116051 Training In Anaesthesia 118357 Core Topics in Airway Management biohemija 4108 *sp* Advances in Medicinal Chemistry, Volume 5 4771 *sp* Advances in Magnesium Research 1 8594 *sp* The Cytokine FactsBook (2nd Edition) 8709 *sp* The Practice of Medicinal Chemistry, Second Edition , 2003 10390 *sp* Clinical Chemistry: Laboratory Management and Clinical Correlations 11451 Voet WIE Biochemistry, 3 Ed, with CD 18851 $QDOLWLюNHWHKQLNHXNOLQLюNRPODERUDWRULMX 18881 Medicinsko biokemijske smjernice 19572 MEDICINSKOBIOKEMIJSKA DIJAGNOSTIKA U ./,1,э.2-35$.6, 19595 STANICA: MOLEKULARNI PRISTUP 19853 *sp* Biochemistry: The chemical reactions of Living Cells, Vol. 1 21531 *sp* Annual Reports in Medicinal Chemistry, No. 39 24202 *sp* ANTIBIOTICS IN LAB MEDICINE 5E 24412 *sp* Informational Biopolymers of Genes and Gene Expression 24910 Thermodynamic Theory of Site-Specific Binding Processes in biological macromolecules 30872 *sp* Reviews of Physiology, Biochemistry and Pharmacology 154 33531 Tietz Clinical Guide to Laboratory Tests,4 Ed 35310 Diagnostic Immunohistochemistry, 2nd edition 36003 Free Radicals in Biology and Medicine (4/e) 36464 *sp* Intl Stdt Ed-Intro to General, Organic & Biochemistry W/Cd 39738 HIGH-YIELD ACID-BASE 2E 40990 Foye's Principles of Medicinal Chemistry, 6e
M. Fingler Kiff, Kevin; Spoors, Catherine Calder/Pearce Allen B. Reitz Ronald Smetana MD Fitzgerald; O'Neill; Gearing Camille G. Wermuth Kent Lewandrowski Donald Voet, Judith G. Voet Bozidar Straus ,YDQDэHSHODN%RеLGDU Straus, S. Dodig (OL]DEHWD7RSLь'UDJDQ 3ULPRUDF6WLSDQ-DQNRYLь G. M. Cooper i R. E. Hausmann David E. Metzler,Carol M. Metzler,David J. Sauke Doherty LORIAN Blake di Cera Susan G. Amara Alan Wu David Dabbs Halliwell, Barry; Gutteridge, John Bettelheim/Brown/Campbell LONGENECKER LEMKE
2010 7497.00 2010 6710.00
2000 1997 2001 2003
3282.00 5947.00 1450.00 1450.00
2002 6374.00
2004 1997 2004
4630.00 2520.00 3150.00
2004 5600.00
2004 8400.00
2001 4636.00
2005 2005 2005
6374.00 7015.00 3903.00
2005 3049.00
2005 8808.00
2006 5855.00 2006 26718.00 2007 5940.00
2006 1450.00
2006 1580.00 2007 5856.00
42164 BIOHEMIJA 43807 Underground Clinical Vignettes STEP 1 BIOCHEMISTRY 43997 Clinical Chemistry Made Easy IE 48947 Tietz's Applied Laboratory Medicine 2e 49840 *sp* The Aptamer Handbook - Functional Oligonucleotides and Their Applications 50572 Biochemistry and Genetics: PSSAR 55660 Lehninger Principles of Biochemistry, 5 Ed 55759 The Origins of Genome Architecture 55786 Biokemija 55788 ./,1,э.$.(0,-$,02/',-$*1267,.$
'DULQND.RUDьHYLь*RUGDQD %MHODNRYLь9LGRVDYD% SWANSON
2006 2007
2700.00 1336.00
Hughes Scott MG Klussmann S
2007 2007 2006
955.00 6527.00 6100.00
Wilson Nelson D. Lynch M. $OHNVDQGDU/XWNLь$OELQ -XULь -DGUDQND6HUWLьLVXUDGQLFL
2008 2007 2008
1341.00 6343.00 4879.00 3500.00
2008 4480.00 7 od 116
56318 Fundamental Laboratory Approaches for Biochemistry Ninfa AJ and Biotechnology, Second Edition
56547 0DUNVRYHRVQRYHPHGLFLQVNHELRKHPLMHNOLQLюNL pristup
Michael Lieberman, Allan D. Marks, Colleen Smith
56877 Chemistry of Fungi
60196 Biodiesel: A Realistic Fuel Alternative for Diesel Engines
Ayhan Demirbas
61348 Clinical Chemistry, International Edition, 6th Edition With STUDENT CONSULT Access
William Marshall
61532 The Practice of Medicinal Chemistry,
Camille Georges Wermuth
61997 %LRKHPLMVNLPDUNHULGLMDJQRVWLNHXNOLQLюNRMSUDNVL 9XNXгLь=YRQLPLUDXWRU YRGLюNUHDWLYQHGLMDJQRVWLNHVDVWHSE\VWHSSURWRNRORP
62099 .OLQLюNL]QDюDMDQDOL]HXULQDDWODVVHGLPHQWDXULQD /DOLь1DWDгDDXWRU
63497 Biochemistry and Molecular Biology (4/e)
Elliott, William H.; Elliott, Daphne C.
65663 Introduction to General, Organic, and Biochemistry Laboratory Manual 9e
Hein M
66437 LANGE INSTANT ACCESS: ACID-BASE, FLUIDS & Reilly ELECTROLYTES
69020 Medical Biochemistry,3 Ed
John Baynes
69264 8UJHQWQLSRUHPHьDMLGLVEDODQVDYRGHLHOHNWUROLWD YRGLюNUHDWLYQHGLMDJQRVWLNHVWHSE\VWHSSURWRNRO UHгDYDQMHGLMDJQRVWLюNLKGLOHPDSULPHQDUDFLRQDOQH reanimacije
9XNXгLь=YRQLPLUDXWRU
70690 Phytoremediation and Rhizoremediation: Theoretical Martina Mackova Background (Focus on Biotechnology)
70817 Harper's Illustrated Biochemistry 28ed ISE
MURRAY
2009 4025.00 2008 2490.00 2008 7686.00 2008 9404.00 2008 2322.00 2008 13420.00 2007 540.00 2005 3564.00 2009 3000.00 2008 12932.00 2008 1702.00 2009 5611.00 2009 540.00 2006 18138.00 2009 2708.00
70901 Biochemistry Primer for Exercise Science (Primers in Exercise Science)
72416 Principles and Techniques of Biochemistry and Molecular Biology
72510 HIGH-YIELD BIOCHEMISTRY 3E
PB
73271 Marks' Basic Medical Biochemistry,3/e, International Student Edition
Michael E. Houston Wilson/Walker WILCOX LIEBERMAN
2006 3599.00 2010 4575.00 2009 1580.00 2009 4270.00
73477 LIPPIN ILLUS Q&A REVIEW BIOCHEMISTRY PB LIEBERMAN
73479 BRS Biochemistry, Molecular Biology, and Genetics, BRS (SWANSON) Fifth Edition
74550 Principles of Biochemistry
Voet, Donald
77127 Strausova medicinska biokemija
'XEUDYNDэYRULгьHF,YDQD эHSHODN
78211 Schaum's Outline of Biochemistry, Third Edition (Schaum's Outline Series)
Kuchel ; Easterbrook-Smith ; Montague ; B; Slaytor
79009 Essential Stem cell methods,
Robert Lanza
81098 Oxford Handbook of Clinical and Laboratory Investigation (3/e)
Provan, Drew
81986 RENAL ELECTROLYTE DISORDERS 7E PB
SCHRIER
82782 CONCISE REVIEW CLIN LAB SCIENCE 2E PB
HUBBARD
109305 %LRKHPLMVNLPDUNHULGLMDJQRVWLNHSULUXюQLNGLMDJQRVWLNH =YRQLPLU9XNXгLь
109306 Diferencijalna dijagnostika urinarnog nalaza
=YRQLPLU9XNXгLь
109704 Lippincott's Illustrated Reviews: Biochemistry, 5e
Harvey
111556 Mathematics for the Clinical Laboratory,
Lorraine J. Doucette
2010 3288.00 2009 3044.00
2007 5367.00 2009 8820.00
2009 1463.00
2009 5611.00 2010 3495.00
2010 2009 2010 2010 2010 2010
6466.00 4270.00 486.00 378.00 3044.00 4269.00
8 od 116
111765 Rapid Review Biochemistry,3ed
John W. Pelley
112138 Textbook of Biochemistry with Clinical Correlations 7e (WSE)
Devlin TM
112331 Deja Review Biochemistry, Second Edition
Saad M. Manzoul
112530 Biochemistry and Genetics: Pretest Self-Assessment Golder N. Wilson and Review, Fourth Edition (PreTest Basic Science)
112551 Laboratory Medicine: The Diagnosis of Disease in the Michael Laposata Clinical Laboratory (Lange Basic Science)
113639 Biochemistry, Fourth Edition
Voet D
114262 Biochemistry, Third Edition
Pankaja Naik
114351 FLUIDS ELECTROLYTES MIE UK EDITION PB
SCOTT
114593 Mosby's Diagnostic and Laboratory Test Reference, Kathleen Deska Pagana
114780 Schaum's Outline of General Organic and Biochemistry Odian for Nursing and Allied Health
114837 Clinical Biochemistry
Ahmed, Nessar
114845 Biochemistry (4/e)
McKee, Trudy; McKee, James R.
116013 Lecture Notes - Clinical Biochemistry 8e
Beckett G
116270 Essential Biochemistry for Medicine
Fry M
117712 Stanica, 5. izdanje
G. M. Cooper i R. E. Hausmann Gordan Lauc, urednik
biomedicinsko inzinjerstvo
4996 *sp* Biomechanics: Principles and Applications
Schneck Daniel J
15691 Applied Bioremediation and Phytoremediation (Soil Biology)
Ajay Singh and Owen P. Ward
18818 Fizika za studente u medicini I deo
-DVPLQND%UQMDV.UDOMHYLь
31793 *sp* Bioengineering Fundamentals
Ann Saterbak
2010 3171.00 2010 5977.00
2010 1610.00 2010 2561.00
2010 5245.00
2010 2009 2010 2010 2009
6099.00 6343.00 2800.00 3903.00 1463.00
2010 3750.00 2009 4751.00
2010 3049.00 2010 2439.00 2010 10920.00
2003 4087.00 2004 18138.00 2001 1750.00 2006 1450.00
37825 0HGLFLQVNRLQIURPDWLюNHPHWRGH
Kern
53283 Biotechnology for Beginners
Reinhard Renneberg
56801 Molecular Biology and Biotechnology
Kreuzer H
66401 Biotechnology
Smith
69049 Bioimpedance and Bioelectricity Basics,
Sverre Grimnes
69592 MEDICINSKA INFORMATIKA
Josipa Kern i Mladen 3HWURYHюNL
74184 Illustrated Dictionary of Biotechnology
Arora
74515 Organic Electronics in Sensors and Biotechnology (McGraw-Hill Biophotonics)
Ruth Shinar, Joseph Shinar
76675 Molecular Biotechnology 4e - Principles and Applications of Recombinant DNA
Glick BR
79009 Essential Stem Cell Methods,
Robert Lanza
80801 Statistics in Human Genetics and Molecular Biology (Chapman & Hall/CRC Texts in Statistical Science Series)
Reilly
112224 Information Retrieval: A Health and Biomedical Perspective
William Hersh
116064 Advanced Electroporation Techniques in Biology and Pakhomov Medicine
dermatovenerologija
280 *sp* Strategies for Immunointerventions in Dermatology Burg, Dummer
400 *sp* Occupational Skin Disease 3Ed
Adams
2006 2007 2008 2009 2008 2009
1400.00 2434.00 6588.00 2805.00 9272.00 3500.00
2009 4147.00 2009 13419.00
2010 10974.00
2009 5611.00 2009 4757.00
2008 6231.00 2010 10858.00
1997 900.00 1999 900.00 9 od 116
2741 *sp* Die Haut als Abwehrorgan
Braun
2745 *sp* Wцrterbuch der Kosmetik
Fey
5253 *sp* Atlas of Allergic Diseases
Lieberman
5671 *sp* Atlas of Human Hair: Microscopic Characteristics Fox; Ogle
18898 DEKUBITIS
-DQNR3DQюHYLь
30823 Thieme's Pocket Guide Dermatology
Sterry,Paus,Burgdorf
37001 Women's Dermatology, An Issue of Dermatologic Clinics
Kathy Schwarzenberger
37622 0HGHQLFD1LNROLьLVDUDGQLFL'HUPDWRYHQHURORJLMD
0HGHQLFD1LNROLьL saradnici
39710 *sp* SAUERS MANUAL SKIN DISEASE 9E CB
HALL
39742 *sp* ATLAS HISTOPATHOLOGY OF SKIN 2E
ELDER
47442 Clinical Guide: Skin and Wound Care (Clinical Guide to Cathy Thomas Hess Wound Care (Hess/ Springhouse))
51236 Dermatology, 2nd Edition 2-Volume Set
Jean Bolognia
53888 CURRENT DIAGNOSIS & TREATMENT OF sexually transmitted diseases
KLAUSNER
55165 Braun-Falcoґs Dermatology,3 Ed
Walter H.C. Burgdorf,Gerd Plewig, Helmut Heinrich
57994 DERMATOVENEROLOGIJA
-DVQD/LSR]HQюLь
59055 LEVERS HISTOPATHOLOGY OF THE SKIN 10E CB ELDER
60011 Dermatology: Fundamentals of Practice
Robin Graham-Brown, Johnny Bourke, Tim Cunliffe
62016 Leg Ulcers 3rd Edition
Negus et al
63677 Dermatopathology,
Dirk Md Elston
65667 Fitzpatrick's Color Atlas and Synopsis of Clinical
Klaus Wolff, Richard Allen
Dermatology: Sixth Edition (Fitzpatrick's Color Atlas & Johnson
Synopsis of Clinical Dermatology)
67423 Handbook of Cosmetic science and technology, Third Edition
71582 Dermatological Signs of Internal Disease,4 Ed
Jeffrey P. Callen
72562 Diagnostic Atlas of Melanocytic Pathology Expert Consult: Online and Print
Phillip H. Mckee
2002 1998 2006 2006
400.00 400.00 5270.00 3233.00 3500.00 5395.00 7563.00
2007 1566.00
2006 1500.00 2006 10523.00 2007 2989.00
2007 31842.00
2007 3355.00
2009 25969.00
2008 7000.00 2008 26718.00 2008 5367.00
2005 12810.00 2008 7929.00 2009 7075.00
2009 20130.00 2009 12566.00 2009 17202.00
73015 Dermatopathology: The Basics 73314 COLOR ATLAS AND SYNOPSIS OF PEDIATRIC DERMATOLOGY, 2 ED -ISE
Bruce R. Smoller, Kim M. Hiatt KANE
2009 5664.00 2009 4331.00
74465 Life-Threatening Dermatoses and Emergencies in Dermatology
74468 Dermoscopy - An Atlas
Scott W. Menzies, Kerry A. Crotty, Christian Ingva
74469 Urticaria and Angioedema, Second Edition
74701 Dermatopathology, Third Edition
Raymond L. Barnhill, A. Neil Crowson, Cynthia M. M
74723 Atlas and Synopsis of Contact and Occupational Dermatology
Sanjay Ghosh
74724 Nail Atlas: A Clinical Approach
K.J.P.S. Puri
76816 Infectious Diseases of the Skin
Elston DM
76889 Cosmetic Dermatology: Products and Procedures, 1 Ed Draelos Z
77128 DERMATOLOSKA ONKOLOGIJA
-DVQD/LSR]HQюLь$LGD
2009 9066.00 2009 7075.00 2009 18300.00 2010 28669.00 2009 8173.00 2009 9149.00 2009 7320.00 2010 18178.00 2009 2520.00 10 od 116
3DгLьLVXUDGQLFL
80420 Dermatologija
Gernot Rassner
81003 Paediatric Dermatology
Lewis-Jones, Sue
81107 Oxford Handbook of Medical Dermatology
Burge, Susan; Wallis, Dinny
81930 *OMLYLюQHLQIHNFLMHNRеHXGHюLMHPX]UDVWX
.UVWLь1HERMгD-DXWRU
82692 SAUERS MANUAL OF SKIN DISEASES 10E CB HALL
82721 3UHYHQFLMDGHWHNFLMDLOLMHюHQMHGHNXELWXVD
+DQюHYLь-LVXU
110358 Step by Step Management of Burns
Sujata Sarabahi, S.P. Bajaj
111774 Dermatology Secrets Plus,4ed
James E. Fitzpatrick
112177 Clinical Dermatology 4e
Weller R
112339 Dermoscopy: An Illustrated Self-Assessment Guide Robert Johr, Wilhelm Stolz
112342 Step by Step Chemical Peels
Niti Khunger
112343 Pediatric Dermatology
Arun Inamadar, S Sacchidanand
113455 Dermatology in Clinical Practice
Zohra Zaidi, S. W. Lanigan
113941 Genetic Skin Disorders ()
Sybert, Virginia
114248 VISUAL DX ESSEN PED DERMATOLOGY CB GOLDSMITH
114728 Acute Adult Dermatology - A Colour Handbook
CREAMER
114733 PSORIASIS
MENTER
115468 Dermatovenerologija sa propedevtikom : udzbenik za /DOHYLь9DVLь%RVLOMND0
studente medicine
autor
116131 LIPPIN PRIMARY CARE DERMATOLOGY CB HSU
117694 Flaps and Grafts in Dermatologic Surgery,
Thomas E. Rohrer
118476 Odabrana poglavlja iz pedijatrijske dermatologije
Situm, M., (ur.)
endokrinologija
382 *sp* Year Book of Endocrinology 1999
Bagdade
14581 Endocrine System and Selected Metabolic Diseases Frank H. Netter i Peter H.
(Netter Collection of Medical Illustrations, Vol 4)
Forsham
18904 'LMDEHWLюNRVWRSDOR
-DQNR+DQюHYLь
26610 BOLESTI HIPOFIZE
Branka Vizner i suradnici
26628 Pathology and Genetics of Tumours of Endocrine
Ronald A. Delellis,Ricardo
Organs (IARC/World Health Organization Classification V. Lloyd,Phillipp U. He
of Tumours)
47438 Greenspan's Basic & Clinical Endocrinology, 8 Ed ISE GARDNER
48403 Williams Textbook of Endocrinology, 11th Edition
Henry M. Kronenberg
48920 Male Sexual & Reproductive Dysfunction Pathophysiology and Treatm
Kandeel Fouad R
50096 %2/(67,в7,71-$э(.OLQLюNDWLUHRLGRORJLMD
Miljenko Solter
55727 Tiroidna zlezda
7UERMHYLь%RеR
55740 Neuroendokrinoimunologija
59858 Oxford Handbook of Endocrinology and Diabetes (2/e) Wass, John; Turner, Helen
60395 Meyler's Side Effects of Endocrine and Metabolic Drugs Jeffrey K. Aronson (Meylers Side Effects) (Meylers Side Effects)
61273 Basic Medical Endocrinology
H. Maurice Goodman
62049 Hyperlipidaemia Third Edition
Durrington, P.N.
66413 Pediatric Endocrinology and Inborn Errors of Metabolism
Kyriakie Sarafoglou, Georg F. Hoffmann, Karl S. Ro
66476 WASH MANL SUBSPEC CONS ENDOCRINOL 2E - WASHINGTON UNIV ISE
66726 OSTEOPOROSIS GUIDE TO DIAG MANAGEMENT CAMACHO PB
2004 2010 2010 2008 2010 2009 2009 2010 2008 2010 2010 2010
7020.00 5621.00 4120.00 983.00 6099.00 4116.00 3537.00 4513.00 5484.00 9271.00 3171.00 17201.00
2010 2010 2009 2010 2010 2010
3396.00 13756.00 8052.00 3654.00 4880.00 1674.00
2010 6588.00 2009 14884.00 2010 2205.00
1999 400.00 2000 7929.00
2005 2004
2800.00 3500.00 8017.00
2007 3654.00 2007 15738.00 2007 35990.00
2007 1998 2000 2009 2008
3360.00 779.00 649.00 2875.00 4879.00
2008 2007 2009
3050.00 9150.00 6587.00
2008 2867.00
2007 3111.00
11 od 116
71858 Endocrine Secrets, 5th Edition
Michael T. Mcdermott
2009 4025.00
72404 Atlas of Thyroid Surgery: Principles, Practice, and Clinical Cases 72406 The Thyroid and Reproduction (Merck European Thyroid Symposium Riga 2009, May 22-25)
Ernst Gemsenjaeger John Lazarus, Valdis Pirags, Sigrid Butz
2008 11875.00 2009 1075.00
72407 The Thyroid and Autoimmunity(Merck European Thyroid Symposium)
Wilmar M. Wiersinga, Hemmo A. Drexhage, Anthony P.
72433 Yen & Jaffe's Reproductive Endocrinology , 6th Edition Jerome F. Strauss Expert Consult - Online and Print
72463 Lymphedema Management
Joachim E. Zuther
72513 MANUAL ENDOCRIN & METABOLISM 4E PB
LAVIN
72619 Oxford Handbook of Diabetes Nursing, 1 ed
Avery, Lorraine; Beckwith, Sue
72996 The Bethesda System for Reporting Thyroid Cytopathology: Definitions, Criteria and Explanatory Notes
Ali, Syed Z.; Cibas, Edmund S.
74727 Clinical Endocrinology & Diabetes Mellitus (TwoVolume Set)
Y Sachdev
76743 McGraw-Hill Manual Endocrine Surgery
Shane Y. Morita, Alan P. B. Dackiw, Martha A. Zei
76747 Pediatric Practice Endocrinology
Michael S. Kappy, David B. Allen, Mitchell E. Ge
76882 Lecture Notes - Endocrinology and Diabetes
Sam A
77125 DIJABETES U ZENA
-RVLSHOPLг0DULQD ,YDQLгHYLьдHOMNR0HWHONRL
77954 Pediatric Endocrinology,
Mark A. Sperling
82073 Harrison's Endocrinology
Jameson
82418 Thyroid Function Testing (Endocrine Updates)
110418 вWLWDVWDеOH]GDLWUXGQRьD
9RMYRGLь/-LOMDQD%
111567 Endocrinology, 2-Volume Set,6ed
J. Larry Jameson
112679 Endocrine Physiology, Third Edition (Lange Physiology Patricia E. Molina Series)
113391 Thyroid Cytopathology: 8 (Essentials in Cytopathology) Douglas P. Clark, William C. Faquin
113436 Gestational Diabetes During and After Pregnancy
113438 Atlas of Thyroid Lesions
115060 The Netter Collection of Medical Illustrations: The Endocrine System,2
William F. Young
115475 Guide pratique du diabиte
Andrй Grimaldi, Agnиs Hartemann-Heurtier, Marine H
116027 ABC of Diabetes 6e
Holt T
116028 A Practical Manual of Thyroid and Parathyroid Disease
Arora A
118478 'LMDEHWLюNRVWRSDOR±3ULUXюQLN
+DQюHYLь-LVXU
epidemiologija i medic.statistika
18819 Epidemiologija
Vladimir Babus
18909 Epidemiologija zaraznih bolesti
Darko Ropac
18911 3ULUXюQLN]DVMHPLQDUHLYHеEHL]HSLGHPLRORJLMH
$ULMDQD9RUNR-RYLь
19586 EPIDEMIOLOSKE METODE
Babus
19587 23ы$(3,'(0,2/2*,-$
'LQNR3XQWDULьL'DUNR
2007 1075.00
2009 18910.00
2009 2009 2009
6475.00 3532.00 2375.00
2009 3396.00
2009 20739.00
2009 6343.00
2009 7319.00
2009 2805.00 2009 3920.00
2008 2010 2010 1999 2010 2009
9393.00 6343.00 15870.00 1296.00 31476.00 4025.00
2010 7563.00
2010 8499.00 2010 15870.00 2010 7807.00
2009 6885.00
2010 3171.00 2010 7197.00 2010 1764.00 1997 2380.00 2003 4900.00 2002 1512.00 2000 1750.00 2004 1400.00 12 od 116
Ropac
47951 Basic Epidemiology 2 Rev ed
R. Bonita; R. Beaglehole; T. Kjellström
54741 Epidemiology ,
Leon Gordis
55790 MODERN EPIDEMIOLOGY 3E
CB
ROTHMAN
60037 Easy Interpretation of Biostatistics,
Gail F. Dawson
76744 PDQ Epidemiology (Pdq Series)
David L. Streiner, Geoffrey R. Norman
113914 A Clinician's Guide to Statistics and Epidemiology in Ghaemi Mental Health
115354 (3,'(0,2/2*,-$.521,э1,+1(=$5$=1,+ BOLESTI
$9RUNR-RYLь06WUQDG, Rudan
115355 EPIDEMIOLOGIJA ZARAZNIH BOLESTI
'5RSDF'3XQWDULьL suradnici
116011 Obesity Epidemiology (2/e)
Crawford, David; Jeffery, Robert W.; Ball, Kylie;
farmacija
2748 *sp* Qualitдt pflanzlicher Arzneimittel
Hanke
2759 *sp* Fremdstoffe in Lebensmitteln
2760 *sp* Lehrbuch der physikalischen Chemie in elementarer Darstellung
Eggert
2762 *sp* Heilpflanzen Sanfte Behandlung von Alltagsbeschwerden
Pahlow
2763 *sp* Apotheker in der pharmazeutischen Industrie
Brauer
2771 *sp* Biotechnologie der Arzneistoffe
Kreis
2774 *sp* Biogene Arzneistoffe
Rimpler
2940 Essential of Pharmaceutical Chemistry
Donald Cairns
3441 Medicines, Ethics and Practice: A guide for pharmacists
3443 Global Ingrediente and Formulation Guide 2002 English version
4064 *sp* Binding Constants:The Measurement of Molecular Kenneth A.Connors Complex Stability
4105 *sp* Alkaloids: Chemical and Biological Perspectives, S. William Pelletier Volume 14
4881 *sp* Art & Science of Nail Technology 4 Ed
Milady
5115 *sp* German Drug Law
5116 *sp* Genetic Engineering Law
Hasskarl
5117 *sp* European Genetic Engineering Law
Hasskarl
5118 *sp* EC Guide to Good Manufactoring Practice for Medicinal Products and Active Pharmaceutical Ingredients
Gert Auterhoff
8359 *sp* Validation Fundamentals: How To, What To, When Gibson To Validate
8362 *sp* Aseptic Pharmaceutical Manufacturing II: Applications for the 1990s
Groves
8373 *sp* Fluid Sterilization by Filtration: The Filter Integrity Johnston Test and Other Filtration Topics, Second Edition
8375 *sp* Ocular Theraputics and drug delivery
Reddy
9682 WHO Model Formulary, 1 edition
Dinesh K Mehta
9683 *sp* Annual Register of Pharmaceutical Chemists 2003 RPSGB
10279 *sp* Compilance Handbook for Pharmaceuticals, Medical Devices, and Biologics
Carmen Medina
10280 *sp* Drug Discovery Strategies and Methods
Alexandros Makriyannis
2006 2739.00
2008 2008 2008 2009
4391.00 6344.00 2561.00 3171.00
2009 3415.00
2010 3080.00
2010 2030.00
2010 7503.00
400.00 400.00 400.00
400.00
2000 2002 2002
400.00 400.00 400.00 2556.00 1275.00 1465.00
1987 12926.00
1999 7466.00
2004 1999 2000 2002 2006
900.00 2614.00 1485.00 4277.00 3704.00
1998 5673.00
1995 7320.00
1997 6039.00
1995 2002 2003 2003
8540.00 2556.00 400.00 10393.00
2003 9327.00 13 od 116
10489 Chronotherapeutics 10494 Pharmacy Pre-registration Handbook 2nd edition 10495 Practical Exercises in Pharmacy Law and Ethics 2nd edition 11889 Pharmaceutical Compounding and Dispensing
16759 REMINGTON SCIENCE & PRAC 21E
CB
17506 Pocket Guide to Herbal Medicine
18884 Farmakokinetika 19526 Register zdravil Republike Slovenije 2005 god. 20539 *sp* Dale and Appelbe's Pharmacy Law and Ethics, 8 Ed 20542 Information Technology for Pharmacists 20543 Introduction to Pharmaceutical Calculations, 2 Ed
20544 Pharmaceutical Calculations Workbook 20545 Locum Pharmacy, 2 Ed 25770 Pharmaceutical Analysis, 26729 BENZODIAZEPINI U SUVREMENOJ MEDICINI
27669 Manual For Pharmacy Technicians
29134 .OLQLюNDIDUPDFLMDLWHUDSLMD 29667 Drug Treatment in Urology 30699 The Merck Index, 14th edition 30951 Physicochemical Principles of Pharmacy 4th Edition 32309 Registar lekova Republike Makedonije za 2006 god. 33531 Tietz Clinical Guide to Laboratory Tests,4 Ed 36361 Pharmacy Law and Practice, 4th edition 36519 Oxford Handbook of Clinical Pharmacy 39721 LIPPIN NURSING DRUG GUIDE 2007 40990 Foye's Principles of Medicinal Chemistry, 6e
Redfern Taylor Gordon E. Appelbe, Joy Wingfield, Lindsay M. TayLo Marriot/Wilson/Langley/Belc her USIP Karin KraftiChristopher Hobbs (VWHUD.XQHF9DMLь G.E. AppelbeiJoy Wingfield Richard Fisher Judith A. Rees,Ian Smith,Brian Smith Ian SmithiJudith A. Rees Pamela Mason David G. Watson 0LUR-DNRYOMHYLьL=GUDYNR /DFNRYLь American Society of HealthSystem PharmacistsiAmer WALKER, EDWARDS Eardley Merck A. T. Florence & D. Attwood Alan Wu Jon Merrills Wiffen, Philip KARCH LEMKE
2003 2002 2002
9608.00 3196.00 2556.00
2006 5118.00
2005 12139.00 2004 3775.00
2004 2005 2005
1750.00 1131.00 990.00
2005 3452.00 2005 2556.00
2005 2004 2005 2001
2556.00 1659.00 4391.00 1750.00
2004 8782.00
2004 2005 2006 2005 2006 2006 2006 2006 2006 2007
5810.00 6039.00 9271.00 4477.00 4320.00 5855.00 7319.00 2750.00 2190.00 5856.00
42248 Herbal Medicines 3rd Edition
Barnes/Anderson/Phillipson
43988 Pocket Essentials of Clinical Medicine, International Edition, 4th Edition
Ballinger & Patchett
46909 PDR for Herbal Medicines 4e
PDR
46948 NACIONALNI REGISTAR VETERINARSKIH LEKOVA 2007
48444 Global Pharmaceutical Marketing: Codes of Practice Judith Grice
48445 Physical Pharmacy (Fast Track)
48447 MCQS in Clinical Pharmacy
49111 Stockley's drug interactions 8th Edition
Karen Baxter (ed)
49839 *sp* Prime Ayurvedic Plant Drugs
Sukh, Dev
50188 *sp* Drug Benefits & Risks - International Textbook of Van Boxtel CJ Clinical Pharmacology
53551 Farmaceutska tehnologija sa biofarmacijom
Gordana Vuleta
53821 Essentials of Pharmaceutical Chemistry, 3 Ed
Donald Cairns
54054 Nacionalni registar lekova Srbije i Crne Gore 2008
55713 Antibiotici 2001
57498 Principles and Practice of Pharmaceutical Medicine Edwards LD
2007 9608.00 2007 1775.00
2008 4392.00 2007 1188.00
2007 2007 2007 2007 2005 2001
16013.00 2171.00 2556.00 17294.00 6039.00 7625.00
2007 864.00 2008 3196.00 2008 1782.00 1168.00 2007 15250.00 14 od 116
2e
58729 PDR Concise Drug Guide for Pediatrics
PDR
60120 Applied Pharmaceutical Practice
Chris Langley, Dawn Belcher
60166 Complementary and Alternative Medicine (Fasttrack) Steven B. Kayne
60276 PHARMACOECONOMICS AN INTRODUCTION PB RASCATI
60345 Meyler's Side Effects of Herbal Medicines,
Jeffrey K. Aronson
61025 Real World Drug Discovery,
Robert Rydzewski
61239 )DUPDNRWHUDSLMVNLYRGLю
61740 Toksikologija
-RNDQRYLь0LODQDXWRU
61959 /HNRYLXSURPHWXSULUXюQLNROHNRYLPDLQMLKRYRM primeni
62172 $QWLPLNUREQLOHNRYLSULUXюQLN]DWHUDSLMXLQIHNFLMD
.DеLь7RPLVODYDXWRU
62175 7HUDSLMDEROQLKVLQGURPDSULUXюQLN
.DеLь7RPLVODYDXWRU
62176 1HXURIDUPDNRWHUDSLMD3VLKRIDUPDNRWHUDSLMDSULUXюQLN .DеLь7RPLVODYDXWRU za terapiju u neurologiji i psihijatriji
62229 Magistralne formule 2008
*RUGDQD9XOHWD-HOD0LOLь
62230 Nacionalni registar lekova Srbije i Crne Gore 2009
65805 PHARMACOTHERAPY HANDBOOK 7 ISE
Barbara G. Wells, Joseph T. Dipiro, Terry L. Schwi
66841 Pharmacy Ethics and Decision Making (First edition) Joy Wingfield
67040 Non-Prescription Medicines 3rd Edition
Alan Nathan
67043 Rote Liste 2009
67066 Handbook of Pharmaceutical Excipients 6th Edition Rowe/Sheskey/Quinn
67772 Medicinal Natural Products - A Biosynthetic Approach 3e
Dewick P M
69029 Trease & Evans Pharmacognacy 16th IE
Evans
69867 *RWRYLOHNRYLSULUXюQLN]DIDUPDNRWHUDSLMXL]GDQMH .DеLь7RPLVODYDXWRU
70100 /HNRYLXSURPHWXSULUXюQLNROHNRYLPDLQMLKRYRM primeni
70463 3ULUXюQLNL]NR]PHWRORJLMHL]GDQMH
Dragana Vasiljevic, 6QHеDQD6DYLь/MLOMDQD RUяHY
71308 Pharmaceutical Practice 4th IE
Winfield
71531 Pharma-Ecology: The Occurrence and Fate of Pharmaceuticals and Personal Care Products in the Environment 71667 British National Formulary , BNF 58 71828 Psychiatric Drugs Explained, 5th Edition
Jjemba PK Bnf David Healy
71880 Drugs in Use (Fourth edition) 71885 A Practical Guide to Licensing Herbal Medicinal Products 71886 Basic Pharmacokinetics 71887 MCQs in Pharmacy Practice - 2nd Edition 71889 Fast Track: Applied Pharmaceutical Practice 71892 Hospital PreRegistration Pharmacis Training 71894 Fast Track: Pharmaceutics - Delivery and Targeting
Edited by Linda J Dodds Brendler/Phillips/Speiss Sunil S Jambhekar Lilian M. Azzopardi Chris Langley & Dawn Belcher Yvonne Perrie & Thomas Rades
2008 3659.00 2008 3837.00
2008 2008 2008 2008 2008 2001 2008
2171.00 3904.00 4879.00 5855.00 2619.00 1080.00 972.00
2007 2007 2007
378.00 324.00 700.00
2008 2009 2009
4320.00 2160.00 3020.00
2007 2006 2009 2009 2009
3196.00 3837.00 10109.00 31385.00 4264.00
2009 3141.00
2009 1620.00 2009 1080.00
2009 864.00
2009 3415.00 2008 8168.00
2009 3714.00
2008 2561.00
2009 3842.00 2009 32025.00
2009 2009 2009
5123.00 2561.00 2305.00
2009 2556.00 2009 2305.00
15 od 116
71895 Fast Track: Therapeutics
Nadia Bukhari & David Kearney
71900 Introduction to Renal Therapeutics - First Edition
C. Ashley and C. Morlidge
71911 Lecture Notes in Pharmacy Practice
Edited by Lilian M Azzopa
71912 Medicines, Ethics and PracticeA Guide for Pharmacists Rpsgb 33 (July 2009)
72537 CLINICAL
ROWLAND
PHARMACOKINETICS/PHARMACODYNAMICS 4E
74363 Forbidden Drugs (3/e)
Robson, Philip
76748 APPLIED CLINICAL PHARMACOKINETICS
BAUER
77409 An Introduction to Clinical Pharmaceutics
Alexander T Florence
79740 Clinical Pharmacy and Therapeutics Text and Evolve Roger Walker ebooks Package,
80305 L'Informatore Farmaceutico 2010 ( Set di Volumi Iniziali + Aggiornamento Bimestrale Non Piu Mensile)- codice TX0038433
80984 Nacionalni registar lekova Srbije i Crne Gore 2010
/MLOMDQDXNLьLVDUDGQLFL
81012 Wilson & Gisvold's Textbook of Organic Medicinal and BEALE / BLOCK Pharmaceutical Chemistry, 12/e (International Edition)
81115 British National Formulary 59 (BNF 59) 81124 Stockley's Drug Interaction Pocket Companion 2010 81125 Rote Liste 2010 81544 Plant Drug Analysis: A Thin Layer Chromatography Atlas 82032 MARTINS PHYSICAL PHARMACY & PHARMACEUTICAL SCIENCES 5E 82075 Handbook of Clinical Drug Data 82433 L'Informatore Farmaceutico Medicinali 2010
Joint Formulary Committee Baxter, Karen Hildebert Wagner, Sabine Bladt SINKO Smith
83048 European Pharmacopoeia 7th Ed 2011 (volumes 7.07.2) - English.
110783 European pharmacopoeia USB STICK subscription 7th Edition 2011 (volumes 7.0 - 7.2)
110790 Lekovi u prometu 2010- Prirucnik o lekovima I njihovoj Vida Jakovljevic, Momir
primeni
Mikov, Zdenko Tomic
110869 Farmaceutska medicina : odabrana poglavlja
Milica Prostran, Milan 6WDQXORYLь'UDJRPLU Marisa
111000 British Pharmacopoeia 2011 6 vol. boxed set (print + Stationery Office (U. k.) CD)
112408 Conducting Your Pharmacy Practice Research Project Felicity J Smith (Second edition)
112423 Medicines Use ReviewsA Practical Guide
Susan Youssef
112451 British National Formulary 60 (BNF
Joint Formulary Committee
112648 PHARMACEUTICAL CALCULAT 13E (INT ED) CB ANSEL
114198 Pharmacology & Pharmacokinetics: A Basic Reader Tomlin (Competency-Based Critical Care)
114245 BASIC CLINICAL PHARMACOKINETICS 5E PB
WINTER
115914 Ja farmaceut
0LKDMORYLь*RUGDQD XURYLь'UDJDQ8URгHY Dubr
116050 Drugs in Palliative Care
Dickman, Andrew
2009 2305.00
2008 2009 2009
3837.00 5123.00 3203.00
2010 5246.00
2009 1874.00 2008 3325.00
2010 3201.00 2007 6221.00
2010 45765.00
2010 1620.00 2010 4697.00
2010 2010 2010 2009
3842.00 2945.00 10109.00 9066.00
2010 4874.00
2010 4513.00 2010 2970.00
2010 54900.00
2010 48800.00
2010 1188.00
2009 4860.00
2010 111386.00
2010 2048.00
2010 2010 2010 2010
3201.00 4482.00 6100.00 4530.00
2009 5368.00 2003 702.00
2010 3120.00 16 od 116
116132 THE HERBAL GUIDE
PB
BONAKDAR
117494 L'Informatore Farmaceutico 2010 - aggiornamento settembre 2010 (supplement septembre 2010
farmakologija
39 Pharmacotherapeutics & Advanced Nursing Practice Eisenhauer, Murpby
3165 *sp* Medical pharmacology at a glance -IE
Neal, Michael J.
4154 *sp* Child and Adolescent Clinical Psychopharmacology
Green
5539 *sp* Lyophilization: Introduction and Basic Principles Thomas A. Jennings
8169 *sp* Opthalmic Drug Delivery Systems (Drugs and the Ashim K. Mitra Pharmaceutical Sciences, 130)
8182 *sp* Microbial Multidrug Efflux
Ian T. Paulsen, Kim Lewis
8236 *sp* Clinicians' Guide to Aspirin
Antony Bayer
8360 *sp* Documentation Systems: Clear and Simple- video Vesper
8956 The Maillard Reactions in Foods and Medicine (Special J. O'Brien, H. E. Nursten, J.
Publication (Royal Society of Chemistry), 223)
Crabbe
10411 *sp* Physicians' Desk Reference Supplement A 2003 Medical Economics Company
10718 The ABC Clinical Guide to Herbs
Mark Blumenthal
11878 Dictionary of Pharmacovigilance
Amer Alghabban
11879 The Medicinal Uses of Cannabis and Cannabinoids Geoffrey Guy
11887 Concordance
Bond
14099 *sp* Lipases and Phospholipases in Drug Development G??nter M??ller, Stefan
: From Biochemistry to Molecular Pharmacology
Petry
14492 Extended Stability for Parenteral Drugs
Caryn M. Bing
15907 The organic chemistry od Drug Design and Drug Action, 2 Ed - IE
Silverman
16420 Drugs of Abuse, 2 Ed
Simon Wills
18019 Farmakologija, 5 edicija, prevod
Rang i Dale
18822 3RPRьQHWYDULXOMHNRYLPD
0HOLWDвDNRYLь3HWUXгLь
19588 VITAMINI I MINERALI
0DULFD0HGLьвDULь
21717 *sp* Laboratory Auditing For Quality And Regulatory Donald Singer,Raluca-
Compliance (Drugs and the Pharmaceutical Sciences: Ioana Stefan,Jacobus Van
a Series of Textbooks and Monographs)
Stad
24201 APPLIED PHARMACOKINETICS AND PHARMACODYNAMICS : PRINCIPLES OF THERAPEUTIC DRUG MONITORING 4 Rev ed
24354 Basic Concepts in Pharmacology
Janet L. Stringer
25484 Color Atlas of Pharmacology, 3 Ed
Heinz Lьllmann,Klaus Mohr,Albrecht Ziegler
25771 Calculations for Pharmaceutical Practice
Winfield
26619 NUSPOJAVE PSIHOFARMAKA
Uzun, Kozumplik, Mimica
29688 Register zdravil Republike Slovenije 2006 god
30271 *sp* Quality of Life - The Assessment, Analysis and Interpretation of Patient-Reported Outcomes 2e
Fayers P
30642 *sp* Rapid Review Pharmacology
Pazdernik
30872 *sp* Reviews of Physiology, Biochemistry and Pharmacology 154
Susan G. Amara
30954 Minor Illness or Major Disease? Responding to Symptoms in the Pharmacy 4th Edition
Clive Edwards & Paul Stillman
31691 Principles of Medical Pharmacology, 7th edition
Kalant
34207 Escop Monographs: The Scientific Foundation for Herbal Medicinal Products
Simon Y. Mills
2010 4630.00 0.00
1998 2002 2001
360.00 400.00 800.00
1999 8967.00 2003 11993.00
2002 1998 1997 1998
5185.00 900.00 4880.00 11433.00
2003 400.00
2003 2004 2004 2004 2004
7555.00 8327.00 4477.00 4477.00 7930.00
2003 7688.00 2004 3240.00
2005 2005 2002 2001 2005
3837.00 3390.00 840.00 3500.00 7807.00
2005 5124.00
2005 2195.00 2005 3775.00
2005 2005 2007 2006
2561.00 1750.00 6480.00 6222.00
2002 1250.00 2005 8808.00
2006 3196.00
2006 7441.00 2003 13932.00
17 od 116
35121 Concise Clinical Pharmacology
Ben Greenstein & Adam Greenste
35581 Further MCQs in Pharmacy Practice
Lillian M Azzopardi
35712 DRUG FACTS & CO POCKET VERSION 2
FACTS & CO
35819 CLINICAL DRUG THERAPY 8E
ABRAMS
36063 PHARMACOLOGY FOR BOARDS AND WARD
AYALA
36197 Integrated Pharmacology, 3rd edition
Clive Page
36848 Basic Concepts in Pharmacology-ISE
Stringer, Janet L.
37821 Rapid Review Pharmacology: With STUDENT CONSULT Online Access (Rapid Review)
Thomas L. Pazdernik, Laszlo Kerecsen
39542 Essential Psychopharmacology: the Prescriber's Guide: Stahl Antipsychotics and Mood Stabilizers
39879 Handbook of Pharmaceutical Manufacturing Formulations Uncompresse
Niazi Sarfaraz K
40871 Pharmacology 6e IE
Rang Dale
42618 Handbook of Pharmaceutical Excipients 2005 Book + CD-ROM
43533 Litt's Drug Eruption Reference Manual, 13th Edition Litt
43746 Handbook of Pharmaceutical Manufacturing Formulations Over-The-Co
Niazi Sarfaraz K
43773 Principles of Pharmacology: The Pathophysiologic Basis of Drug Therapy, 2e
GOLAN
43790 *sp* LIPPIN NURSING DRUG GUIDE 2008
KARCH
43814 Underground Clinical Vignettes STEP 1 PHARMACOLOGY
SWANSON
43995 Clinical Pharmacy and Therapeutics, 4E International Roger Walker Edition,
43996 CLINICAL PHARMACOLOGY 10E IE
Bennett
43998 Pharmaceutical and Medicine Chemistry Int Ed
Watson, D G (Senior Lecturer,Dept of Pharmaceutica
44062 *sp* Drug Information Handbook for Nursing
Beatrice B. Turkoski
44064 *sp* Lexi-Comp's Drug Information Handbook for Dentistry
Wynn, Meiller, Crossley
44870 )$50$.2/2в.,35,58э1,.
44871 )$50$.27(5$3,-6.,35,58э1,.
Bozidar Vrhovac i suradnici
47279 Stahl's Essential Psychopharmacology
Stahl/Muntner
47399 *sp* Springhouse Nurse's Drug Guide 2008 (Springhouse Nurse's Drug Guide)
SPRINGHOUSE
47500 Elsevier's Integrated Pharmacology
Mark Kester
47624 2VQRYQLNRQFHSWLXIDUPDNRORJLMLYRGLю]DVWXGHQWH Janet L. Stringer
48363 Pharmacology Principles: Roadside Assistance (Dvd Alan Agins and Workbook),
48436 Nutraceuticals, 2 Ed
Brian Lockwood
48943 Drug Discovery and Development V 2 - Drug Development
Chorghade MS
49012 Drugs and the Liver
49013 Molecular BiopharmaceuticsAspects of Drug Characterization, Drug Delivery and Dosage Form Evaluation
Edited by Bente Steffanse
50083 *sp* Europдisches Arzneibuch 5. Ausgabe, 5. Nachtrag (Ph.Eur. 5.5)
50084 *sp* Europдisches Arzneibuch 5. Ausgabe, 6. Nachtrag
2006 2556.00
2006 2006 2006 2006 2006 2005 2007
2556.00 4636.00 4514.00 2190.00 5611.00 2196.00 3171.00
2006 2074.00
2004 22326.00
2007 3278.00 2005 44835.00
2007 17690.00 2004 22326.00
2007 2684.00
2007 900.00 2007 1336.00
2007 2927.00
2007 3005.00
2011 1829.00
2007 1679.00 2007 900.00
2007 2007 2008 2007
1750.00 4900.00 3660.00 800.00
2007 2008 2007
3049.00 695.00 2561.00
2007 5118.00 2007 6460.00
2008 3837.00 2009 16013.00
2007 400.00 2007 400.00 18 od 116
(Ph.Eur. 5.06)
50188 *sp* Drug Benefits & Risks - International Textbook of Van Boxtel CJ Clinical Pharmacology
50256 Textbook of Receptor Pharmacology Third Edition
Foreman
51154 *sp* Medicinal Plants of the Asia-Pacific
Wiart
51258 Farmakologija-23. izdanje
9DUDJLь0LORгHYLь
52562 Clinical Ocular Pharmacology, 5th edition
Jimmy Bartlett
54315 Medicinal Chemistry and Pharmacological Potential of Fullerenes and Carbon Nanotubes ( Carbon Materials: Chemistry and Physics)
55109 Pharmacology,
Eugenia Fulcher
55167 Drug Calculations: Process and Problems for Clinical Meta Brown Practice
55799 Index Nominum, International Drug Directory 19 ed,
56217 DRUGS IN PREGNANCY & LACTATION 8E CB BRIGGS
57498 Principles and Practice of Pharmaceutical Medicine 2e
Edwards LD
57985 Registar lijekova Republike Hrvatske za 2008 godinu
57988 A Textbook of Clinical Pharmacology and Therapeutics Tim Mant Fifth Edition
58119 Register zdravil Republike Slovenije 2008 god (br. 11)
58731 PDR Concise Drug Guide for Advanced Practice Clinicians
PDR
59058 Lippincott's Illustrated Review: Pharmacology, International Edition, 4e
HARVEY
59927 Drugs for the Heart, 7th Edition
Lionel Opie
59950 Introduction to Pharmacology
Mary Kaye Asperheim Favaro
59973 Pharmacology: A Handbook for Complementary Healthcare Professionals
Elaine Mary Aldred
60112 *sp* Martindale's Drugs Restricted in Sport 2008 Pocket Companion
60148 Biomarker Methods in Drug Discovery and Development (Methods in Pharmacology and Toxicology)
60402 Meyler's Side Effects of Cardiovascular Drugs (Meylers Jeffrey K. Aronson Side Effects) (Meylers Side Effects)
60403 Meyler's Side Effects of Drugs in Cancer and Immunology (Meylers Side Effects)
61239 )DUPDNRWHUDSLMVNLYRGLю
61532 The Practice of Medicinal Chemistry,
Camille Georges Wermuth
61751 Europдisches Arzneibuch 5. Ausgabe, 7. Nachtrag (Ph.Eur. 5.7)
62035 Drugs and Pregnancy: a handbook
Little, Bertis
65351 Master Medicine: Medical Pharmacology,
Simon Constable
65855 Europдisches Arzneibuch 5. Ausgabe, 4. Nachtrag (Ph.Eur. 5.4)
66408 Clinician's Pocket Drug Reference 2009
Gomella
66813 Sedation, 5 Ed
Stanley F. Malamed
66836 Applied Therapeutics: The Clinical Use of Drugs 9/e KODA-KIMBLE
67571 Introduction to Neuropsychopharmacology
UNKNOWN
67699 Pharmacology and Therapeutics,
Scott Waldman
67766 Brody's Human Pharmacology,5 Ed
Lynn Wecker
2001 7625.00
2010 2006 2009 2007 2008
8539.00 4578.00 2052.00 10979.00 15473.00
2008 5733.00 2007 4757.00 2008 32141.00 2008 10492.00 2007 15250.00 2008 4200.00 2008 3659.00 2008 6728.00 2008 3293.00 2008 2440.00 2008 5611.00 2008 3903.00 2008 5123.00 2008 490.00 2008 11334.00
2008 4879.00
2008 4879.00
2008 2619.00 2008 13420.00 2007 6066.00
2006 2007 2006
3659.00 2927.00 1080.00
2009 2009 2008 2009 2009 2009
975.00 6343.00 14518.00 3752.00 15738.00 5977.00
19 od 116
67767 Pharmacology Condensed,2 Ed 67768 Pharmacology, 3rd Edition With STUDENT CONSULT Online Access
Maureen Dale George M. Brenner
2008 2927.00 2009 4757.00
68841 Antidepressants 69092 A Pharmacology Primer, 69785 Farmakologija 70886 McGraw-Hill's I.V. Drug Handbook 1ed ISE
Stahl Terry Kenakin H.P.Rang; M.M.Dale SCHULL
2009 2009 2009
3049.00 6099.00 9730.00 2349.00
71062 Pharmacology Flash Cards, 2nd Edition
71701 Natural Standard's Herbal Pharmacotherapy,
71881 FAST TRACK: PHARMACOLOGY
71890 Evaluation of Herbal Medicinal Products
73130 PHARMACOLOGY 5E
PB
73312 Basic & Clinical Pharmacology, 11 Ed-ISE
George M. Brenner Catherine Ulbricht RANDALL Edited by Peter Houghton BRS (ROSENFELD) KATZUNG
2009 2009 2009 2009 2009 2009
3171.00 7929.00 2305.00 15372.00 2678.00 3550.00
76337 Pocket Guide: Pharmacokinetics Made Easy, 2 Ed
Donald J. Birkett
79732 Drugs for Pregnant and Lactating Women,
Carl P. Weiner
79738 Pharmaceutical Analysis Text and Evolve eBooks Package: A Textbook for Pharmacy Students and Pharmaceutical Chemists
David G. Watson
80759 Registar lijekova u Hrvatskoj za 2010, 53. izdanje
80826 Stahl's Illustrated Chronic Pain and Fibromyalgia
Stahl/Muntner/Ball
80830 Stahl's Illustrated Attention Deficit Hyperactivity Disorder
Stahl/Mignon
81124 Stockley's Drug Interaction Pocket Companion 2010 Baxter, Karen
81541 Katzung & Trevor's Pharmacology Examination and Board Review, 9 Ed
Trevor
81932 Lek - doza - vreme i pacijent u bolnici
6WDQLPLURYLь9LROHWDDXWRU
81968 Kardiovaskularni lekovi [Elektronski izvor] : 2008 : SULUXюQLN]DWHUDSLMX
.DеLь7RPLVODYDXWRU
81980 PDR Guide to Drug Interactions, Side Effects and Indications 64e
PDR
82031 Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems, 9 Ed
ALLEN
82046 Clinicians Pocket Drug Reference 2010
Gomella
82099 HANDBOOK OF PSYCHIATRIC DRUGS 6E PB ROSENBAUM
83065 Rang & Dale's Pharmacology Flash Cards,
Maureen M. Dale
108963 Goodman and Gilman's Pharmacological Basis of Therapeutics
Brunton
109700 Clinical Drug Therapy, 9e
Abrams
110361 $QWLELRWLFL]DNOLQLюNXSUDNVXSULUXюQLN
.DеLь7RPLVODYDXWRU
110792 Pharmaceutical Compounding and Dispensing 2nd edition
Marriott, John F, Wilson
110793 Non-Prescription Medicines, 4 Ed
Alan Nathan
111846 Rapid Review Pharmacology,3ed
Thomas L. Pazdernik
112379 *,7SULUXюQLN]DWHUDSLMXEROHVWLJDVWURLQWHVWLQDOQRJ .DеLь7RPLVODYDXWRU trakta
112404 Medicines, Ethics & Practice 34 (MEP 34)A Guide for Royal Pharmacautical Soc Pharmacists and Pharmacy Technicians
112408 Conducting Your Pharmacy Practice Research Project Felicity J Smith (Second edition)
112423 Medicines Use ReviewsA Practical Guide
Susan Youssef
2010 2927.00 2009 10735.00 2009 4879.00
2010 2009 2009
4200.00 3049.00 3049.00
2010 2945.00 2010 4269.00
2009 1018.00 2009 432.00
2010 6953.00
2010 4941.00
2010 2009 2010 2011
1097.00 3660.00 2683.00 12078.00
2010 2010 2010
6832.00 540.00 5123.00
2010 2010 2010
4482.00 3171.00 540.00
2010 4482.00
2010 2048.00
2010 3201.00 20 od 116
112520 Pharmacology: PreTest Self-Assessment and Review, Marshal Shlafer Thirteenth Edition (PreTest Basic Science)
113215 Osnove nanomedicine : embriologija, farmakologija, 0LOHQD3DSLь2EUDGRYLь
nanotehnologija
6X]DQD0LOMNRYLь/LGLMD0
113923 Medication Safety
Courtenay/Griffiths
114048 Lecture Notes - Clinical Pharmacology and Therapeutics 8e
McKay GA
114198 Pharmacology & Pharmacokinetics: A Basic Reader Tomlin (Competency-Based Critical Care)
114851 Color Atlas of Pharmacology, 4 Ed
Heinz Lьllmann, Klaus Mohr, Albrecht Ziegler
115950 Drugs In Sport
Mottram, David
116280 PDR for Nutritional Supplements 2e
Hendler SS
116515 Mosby's 2011 Nursing Drug Reference,
Linda Skidmore-Roth
118796 Antipsychotics and their Side Effects
Gardner/Teehan/Baldessari
119297 Understanding Pharmacoepidemiology (Lange Clinical Donna West, Yi Yang Science)
119302 Pharmacotherapy Principles and Practice Study Guide: Michael D. Katz, Kathryn R.
A Case-Based Care Plan Approach
Matthias, Marie A. Chi
121484 Farmakologija
.DеLь7RPLVODYDXWRU
fizikalna medicina
18843 Bolesti lumbosakralne kraljeznice
/XFLMDQ1HJRYHWLь
18863 Kineziterapijski program za osobe oboljele od miastenije gravis
Josipa Gazibara
18869 ,QWHUQLVWLюNDSURSHGHXWLNDLRVQRYHIL]LNDOQH dijagnostike
Zeljko Metelko
18919 )L]LNDOQHRVQRYHLNOLQLюNLDVSHNWLPHGLFLQVNH dijagnostike
6WLSDQ-DQNRYLь
18940 $OJRGLVWURILюQLVLQGURP
,YR-DMLь
18944 Fizijatrijsko reumatoloska propedeutika
,YR-DMLь
30429 *sp* Introduction to Kinesiology
Hoffman, Shirl J.
43444 Physical Rehabilitation,
Michelle H. Cameron
43449 Practical Electrotherapy
John Fox
49872 Krizobolja, 129 str.
Predrag Keros, Bozidar ыXUNRYLь
52008 Complementary Therapies for Physical Therapy
Judith Deutsch
52055 MANUAL OF MUSCULOSKELETAL MEDICINE
55128 Diagnostic Imaging for Physical Therapists,
James Swain
55732 Fizikalna medicina i rehabilitacija-povreda lokomotornog sistema
1LNROLьдDUNR
59888 Physical Diagnosis Secrets: With STUDENT CONSULT Salvatore Mangione Online Access (Secrets)
60776 Scientific Foundations and Principles of Practice in Musculoskeletal Rehabilitation,
David Magee
61932 Fizikalna medicina i rehabilitacija
-HYWLь0LORUDG5DXWRU
61951 .OLQLюNDNLQH]LWHUDSLMD
-HYWLь0LORUDG5DXWRU
65812 Atlas palpatorne anatomije
Serge Tixa
67752 ,VSLWLYDQMHVQDJHPLгLьDPDQXHOQDPHWRGD
Zec, Zivojin - autor
68261 Anatomy and Human Movement Study Cards,
Nigel Palastanga
68268 Respiratory Physiotherapy,
Beverley Harden
69016 ACSM's Exercise is Medicine: A Clinician's Guide to ACSM Exercise Prescription
71644 Mosby's Massage Therapy Review, 3rd Edition
Sandy Fritz
2010 2561.00
2009 2160.00
2009 2927.00 2010 2927.00
2010 4530.00
2010 4315.00
2010 2009 2010 2010 2011
4270.00 4392.00 3171.00 4270.00 4269.00
2011 5245.00
2011 1620.00
1993 1400.00 2002 420.00
1999 2800.00
4200.00
2003 2004 2005 2007 2007 2002
1400.00 2800.00 3288.00 6953.00 2927.00 725.00
2008 2008 2008 2004
4879.00 2922.00 5123.00 1188.00
2007 3171.00
2007 5855.00
2006 2009 2007 2008 2008 2009
4644.00 4644.00 1980.00 594.00 2927.00 2927.00 4026.00
2009 3415.00 21 od 116
71644 Mosby's Massage Therapy Review, 3rd Edition 71651 Mosby's Respiratory Care Online for Egan's Fundamentals of Respiratory Care (User Guide and Access Code 71695 Orthopaedic Physical Therapy, 4th Edition
Sandy Fritz Mosby Robert Donatelli
71770 The Physiotherapist's Pocketbook, 2nd Edition
Karen Kenyon
71777 A Massage Therapist's Guide to Treating Headaches and Neck Pain including DVD, 71779 The Physiotherapist's Pocket Guide to Exercise, 71823 Anatomy Trains, 2nd Edition
Sandy Fritz Angela Glynn Thomas W. Myers
72463 Lymphedema Management
Joachim E. Zuther
74789 McGraw-Hill's NPTE (National Physical Therapy Examination) (Lange)
Mark Dutton
82852 дLYHWLXVSUDYQRSRVOHSRYUHGHNLюPHQHPRеGLQH
%DERYLь5DGH'DXWRU
83021 Minor Injuries,
Dennis Purcell
109697 Kinesiology, 2e
Oatis
109698 MUSCLE TESTING & FUNCTION 5E (INT ED) PB KENDALL
111551 Kinesiology of the Musculoskeletal System,2ed
Donald A. Neumann
111812 Krizobolja
Grazio S., Buljan D.
111872 Rehabilitaciona medicina u traumatologiji i ortopediji -HYWLь00DULь9/R]R 9*DYULь1
114121 Massage for Therapists - A guide to soft tissue therapy 3e
Jones E
114485 Introductory Biomechanics,
Andrew Kerr
114575 Kinesiology,
Joseph E. Muscolino
115051 Evidence-based Therapeutic Massage,
Elizabeth A. Holey
117734 Combined Movement Theory,
Chris Mccarthy
fiziologija
13989 *sp* Biology of Humans 2ed
Judith Goodenough Betty McGuire Robert Wallace
14576 Nervous System: Anatomy and Physiology (Netter Collection of Medical Illustrations, Volume 1, Part 1)
Frank H. Netter
14585 Musculoskeletal System: Anatomy, Physiology, Metabolic Disorders (Netter Collection of Medical Illustrations, Volume 8, Part 1)
Frank H. Netter
18132 Principles Of Exercise Testing and Interpretation
WASSERMAN
Includig Pathophysiology and Clinical Applications, 4/e
20914 Physiology 5ed updated SC , IE 23794 *sp* Textbook of Medical Physiology 11/e IE 26063 Berne & Levy Principles of Physiology 4th IE 26081 MEMMLERS HUMAN BODY HEALTH DIS 1,IE 30566 Anatomy and Physiology 30567 Laboratory Atlas of Anatomy and Physiology 30872 *sp* Reviews of Physiology, Biochemistry and Pharmacology 154 36164 Ross and Wilson's Anatomy and Physiology Colouring and Workbook, 2nd edition 36203 Cardiovascular Physiology, 9th edition 36678 REVIEW OF MEDICAL PHYSIOLOGY, 22 Ed - ISE 37961 Anatomija i fiziologija
Berne Guyton Berne COHEN Saladin, Ken Bertram, John W. Susan G. Amara Anne Waugh Matthew Levy Ganong Predrag Keros, Branka
2009 3415.00 2009 7807.00
2009 8051.00
2009 2927.00
2009 2927.00
2009 2683.00 2008 4025.00
2009 6475.00 2009 6221.00
2010 2010 2010 2010 2009 2009 2009
2160.00 4025.00 5124.00 5124.00 6709.00 4116.00 1026.00
2009 3659.00
2010 2010 2010 2010
3049.00 5001.00 5123.00 5489.00
2004 1450.00 2000 6460.00 1999 6460.00
2004 8540.00
2005 2005 2005 2005 2006 2005 2005
3415.00 4000.00 4371.00 1922.00 5245.00 3659.00 8808.00
2006 2317.00
2006 3415.00 2005 2623.00 2006 1400.00 22 od 116
0DWNRYLь
39738 HIGH-YIELD ACID-BASE 2E
LONGENECKER
48358 HIGH YIELD PHYSIOLOGY
DUDEK
50421 Elsevier's Integrated Physiology
Robert Carroll
54461 Introduction to Modeling in Physiology and Medicine, Claudio Cobelli
55100 Berne & Levy's Physiology 6th IE
Koeppen
56513 Medicinska fiziologija,jedanaesto izdanje
Guyton i Hall
56714 Specijalna patoloska fiziologija,drugo izdanje
Bogdan Beleslin
59939 Netter's Essential Physiology,
Susan Mulroney
60028 Physiology (Crash Course)
Shahid
60302 Medical Physiology Updated SC 2ed
Boron
60730 RESPIRATORY PHYSIOLOGY ESSENTIALS 8E PB WEST
61533 Textbook of Clinical Hemodynamics
Michael Ragosta
65926 +RPHRVWD]DLWHOHVQHWHюQRVWL
0XMRYLь9XMDGLQ0DXWRU
69300 GI sistem i ishrana : integrativna fiziologija
0XMRYLь9XMDGLQ0DXWRU
70784 Human Anatomy and Physiology:International Edition Elaine Marieb Katja Hoehn 8ed
70788 Essentials of Anatomy & Physiology:International Editio Frederic Martini Edwin
5ed
Bartholomew
70889 Case Files: Physiology 2ed ISE
TOY
70890 Medical Physiology: The Big Picture 1ed ISE
KIBBLE
71634 Mosby's Anatomy & Physiology Study and Review Cards, 72412 Color Atlas of Physiology, 6 Ed 73316 Ganong's Review of Medical Physiology, 23rd Ed-ISE
Mosby Agamemnon Despopoulos, Stefan Silbernagl BARRETT
73479 BRS Biochemistry, Molecular Biology, and Genetics, BRS (SWANSON) Fifth Edition
74791 Vander's Renal Physiology, 7th Edition (Lange Physiology Series)
Douglas C. Eaton, John Pooler
74980 An Introduction to Cardiovascular Physiology Fifth Edition
J Rodney Levick
75053 Hard Work:Defining Physical Work Performance Requirements
Brian J. Sharkey, Paul O. Davis
75483 Principles of Physiology for the Anaesthetist 2e
Ian Power
76724 Fiziologija centralnog nervnog sistema
0LODQRYLь=YH]GDQ
77410 A Laboratory Guide to Human Physiology: Concepts & Fox Clinical Applications
77454 EXERCISE PHYSIOLOGY 7E (INT EDITION) CB
MCARDLE
77964 Problem-Based Physiology,
Robert G. Carroll
79742 Berne & Levy Physiology, 6e Updated Edition,-IE International Edition, 6th Edition
Koeppen & Stanton
80897 Poviseni holesterol i ateroskleroza 80942 Fiziologija : sistemski prilaz homeokinezi 81362 The Musculoskeletal System, 2nd Edition
/HSгDQRYLь/D]DUDXWRU /DеHWLь%RJRVDYDXWRU Philip Sambrook
82487 Ross and Wilson Anatomy and Physiology in Health and Illness International Edition, 11th Edition 82488 Guyton and Hall Textbook of Medical Physiology,
Waugh & Grant Hall
2006 2008 2006 2008 2008 2008 2008 2008 2007 2009 2008 2008 2001 2006 2009
1580.00 1464.00 3049.00 7807.00 4098.00 8910.00 1790.00 4757.00 2927.00 5738.00 2196.00 7807.00 1080.00 292.00 5489.00
2009 4315.00
2009 1598.00
2009 2556.00
2009 2317.00
2009 3775.00
2009 2867.00
2009 3044.00
2009 3537.00
2009 3659.00
2008 5612.00
2007 2009 2008
5489.00 1080.00 7929.00
2009 2009 2009
4270.00 3415.00 5054.00
2009 2009 2010
486.00 1620.00 3049.00
2010 1707.00
2010 5489.00 23 od 116
International Edition, 12th Edition
109706 BRS Physiology, 5e,IE
Costanzo
110088 Fluid, Electrolyte and Acid-Base Physiology,
Mitchell L. Halperin
111857 Physiology: with STUDENT CONSULT Online Access, Linda S. Costanzo 4 Ed
112538 Deja Review Physiology, Second Edition
Edward A. Gould
115062 Guyton & Hall Physiology Review,
John E. Hall
115484 ZBIRKA TEST PITANJA IZ FIZIOLOGIJE I IMUNOLOGIJE
0DWNR0DUXгLь'DQND *UюHYLь
116246 PATOFIZIOLOGIJA 7 izd.
6*DPXOLQ00DUXгLь= .RYDюLVXUDGQLFL
116247 PATOFIZIOLOGIJA - zadatci za problemske seminare, Z. KovaЛ, S. Gamulin i
7 izd.
suradnici
gastroenterologija i hepatologija
1587 *sp* Mosby's Color Atlas and Text of Gastroenterology Aspinall and Liver Disease
5567 *sp* Morson & Dawson's Gastrointestinal Pathology Basil C. Morson
9918 *sp* inflammatory bowel diseases
Satsangi
16906 Evidence Based Gastroenterology and Hepatology - IE Burroughs, Andrew K.
18923 Gastroenterologija i hepatologija 1-2
%RULV9XFHOLь
19593 %2/(67,*8в7(5$э(
$QWH%LOLьLVXUDGQLFL
2010 2010 2009
3044.00 5123.00 4757.00
2010 2010 2005
1951.00 2927.00 1750.00
2010 9800.00
2010 4200.00
2002 3940.00
2003 2003 2004 2004 1993
11285.00 7808.00 9150.00 8400.00 2009.00
24036 Sleisenger and Fordtran's Gastrointestinal and Liver Mark Feldman Disease,8 Ed
24335 Grade: Gastroenterology Quick Glance
Edwards
29396 Understanding Gastroesophageal Reflux Disease
Nicholas J., M.D. Shaheen
29664 *sp* Pocket Consultant: Gastroenterology
Travis
30825 The Pelvic Floor
Beate CarriereiFeldt
30881 *sp* Proteases in Gastrointestinal Tissues
Uwe LendeckeliNigel M. Hooper
34619 Oxford Handbook of Gastroenterology and Hepatology Bloom, Stuart
35600 *sp* Radiologic Diagnosis of Gastric Cancer. A New L. M. Portnoy Outlook
36201 Gastrointestinal Physiology, 7th edition
Leonard Johnson
37091 'HюMDJDVWRHQWHURORJLMD
)LOLSRYLь'REULYRMH
43947 Gastrointestinal Imaging, 3rd edition
Robert Halpert
47733 Endosonography, Text with DVD
Robert Hawes
53192 Pearson's Thoracic and Esophageal Surgery,
G. Alexander Patterson
55200 VIRTUAL COLONOSCOPY
CB
YEE
55701 Inflamatorne bolesti creva
8JOMHгLь0LOHQNR
55722 Akutna insuficijencija jetre
55729 Hirurgija pankreasa
5DGRMH%эRORYLь
55735 Slezina
0LOLFD'эRORYLь5DGRMH% эRORYLь
56138 MANUAL GASTROENTEROLOGY 4E -ISE
AVUNDUK
59925 Gastrointestinal System (Mosby's Crash Course Series)
Chew
62011 Management of Abdominal Hernias 3ed
Kingsnorth, Andrew
66478 The Washington Manual Gastroenterology Subspecialty Consult, 2 Ed-ISE
WASHINGTON UNIV
66480 PRIMO GASTRO POCKET GI,LIVER COMPAN PB GUARDINO
2006 24522.00
2004 2005 2005 2006 2006
2927.00 1829.00 2772.00 7555.00 6801.00
2006 3375.00 2006 4533.00
2006 1995 2006 2006 2008 2007 2004 1998
3415.00 648.00 7929.00 18422.00 31476.00 10492.00 1058.00 519.00 584.00 519.00
2008 3904.00 2007 2927.00
2003 17995.00 2008 2867.00
2007 3166.00 24 od 116
67139 Intrevencijska gastroenterologija
0DULMD5RVDQGLь3LODгL saradnici
68247 'LMDJQRVWLюNHGLOHPHKHSDWRORгNLKVLQGURPDLVLQGURPD =YRQLPLU9XNXгLь6WRMDQ
sepse
5DGLь0DMD0LMDLORYLь
69445 Practical Gastrointestinal Endoscopy - The Fundamentals 6e Volume 1
Cotton P
70837 CURRENT Diagnosis and Treatment in
GREENBERGER
Gastroenterology, Hepatology and Endoscopy 1ed ISE
1993 1169.00 2009 486.00 2008 6709.00 2009 4269.00
71191 Ct Colonography: Principles and Practice of Virtual Colonoscopy,
Perry J. Pickhardt
72311 Oxford Handbook of Gastrointestinal Nursing
Norton
72409 Teaching Atlas of Abdominal Imaging
Mukesh G. Harisinghani, Peter R. Mьller
72461 Health through Inner Body Cleansing: The Famous F. Erich Rauch X. Mayr Intestinal Therapy from Europe
73010 Color Atlas of High Resolution Manometry
Conklin
73011 New Liver Anatomy: Portal Segmentation and the Drainage Vein
Munemasa Ryu, Akihiro Cho, Hiroshi Yamamoto
73126 DIAGNOSTIC PATHOLOGY GASTRO AMIRSYS CB GREENSON
74808 McGraw-Hill Manual Colorectal Surgery
Andreas M. Kaiser
76820 Liver Diseases - An Essential Guide for Nurses and Sargent S Health Care Professionals
76822 Endoscopic Ultrasonography 2e
Gress F
80993 Oxford Case Histories in Gastroenterology and Hepatology
Walsh, Alissa J.; Buchel, Otto C.; Collier, Jane;
81363 Netter's Gastroenterology, 2nd Edition (Print Version Martin H. Floch Only)
2009 20496.00 2008 2375.00 2008 10795.00 2008 1939.00 2009 11334.00 2009 17571.00 2009 27572.00 2009 5001.00 2009 4879.00 2009 7319.00 2010 4996.00 2010 7929.00
83032 The Digestive System,
Margaret E. Smith
109418 Cope's Early Diagnosis of the Acute Abdomen ()
Silen, William
110087 Gi/Liver Secrets Plus,
Peter Mcnally
110359 Harrison's Gastroenterology and Hepatology
Dan L. Longo, Anthony S. Fauci
110454 Sleisenger and Fordtran's Gastrointestinal and Liver Disease- 2 Volume Set, 9th Ed, Pathophysiology, Diagnosis, Management, Expert Consult Premium Edition - Enhanced Online Features and Print
Mark Feldman
111792 Endosonography,2ed
Robert H. Hawes
112157 PRAC GUIDE TO ABDOMINAL PELVIC MRI 2E CB LEYENDECKER
115351 ALGORITMI U GASTROINTESTINALNOJ
R. PulaniК i suradnici
ENDOSKOPIJI I ENDOSKOPSKOM ULTRAZVUKU
115353 DEZINFEKCIJA, STERILIZACIJA I SKLADISTENJE FLEKSIBILNIH ENDOSKOPA I ENDOSKOPSKOG PRIBORA
-%UOMDN53XODQLь5 2VWRMLь6.DOHQLь
115365 23ы$,63(&,-$/1$*$6752(17(52/2в.$ ENDOSKOPIJA
0$5,-$526$1',ы3,/$в
genetika
1413 Genomes
T.A. Brown
8457 *sp* Guide to Yeast Genetics and Molecular and Cell Guthrie, Fink Biology part B Methods in Enzymology Vol. 350
8458 *sp* Guide to Yeast Genetics and Molecular and Cell Fink Biology part C; Methods in Enzymology Volume 351
8954 Seeds of Concern: The Genetic Manipulation of Plants David R. Murray
11517 Phenotypic Plasticity: Functional and Conceptual
Thomas J. Dewitt, Howard
2010 2010 2010 2010
3049.00 3439.00 4635.00 6343.00
2010 27572.00
2010 18056.00 2010 11590.00 2010 2100.00 2010 840.00 3081.00 2002 4099.00 2002 1450.00 2002 1450.00 2003 2799.00 2004 7878.00 25 od 116
Approaches 18827 Humana genetika 22121 Understanding DNA, 3rd edition 24412 *sp* Informational Biopolymers of Genes and Gene Expression 24413 DNA Replication 24476 DNA Topology 26622 RACIONALNA DIJAGNOSTIKA NASLJEDNIH I 35,52(1,+%2/(67,
M. Brody, Samuel M. Sche Zergollern Calladine Et Al Blake Kornberg A. BatesiTony Maxwell ,YR%DULь$QD6WDYOMHQLь Rukavina
1994 2004 2005
3500.00 5123.00 3903.00
2005 2005 2005
6953.00 2870.00 2100.00
35521 Color Atlas of Genetics 3ed
Eberhard Passarge
36449 *sp* Student Companion Guide to Accompany Principles of Genetics 4e
Snustad DP
42835 Introduction to Genetic Analysis
Griffiths
45595 Thompson & Thompson Genetics in Medicine, 7th edition
Robert Nussbaum
47509 Medical Genetics (Oxford Core Texts)
Young, Ian D.
47578 Emery's Elements of Medical Genetics, 13th edition Peter Turnpenny
47579 Elsevier's Integrated Genetics
Linda Adkison
48492 Recombinant DNA: Genes and GenomesA Short Course
Watson
50572 Biochemistry and Genetics: PSSAR
Wilson
54084 Molecular Biology of the Gene:International Edition 6ed James Watson Tania Baker Stephen Bell Alexander Ga
55759 The Origins of Genome Architecture
Lynch M.
61720 Principi genetike
HOLь1LQRVODYDXWRU
62050 Respiratory Genetics
Edwin Silverman
62150 Emerijevi osnovi medicinske genetike
Peter D. Turnpenny, Sian Ellard
63516 The Impact of the Gene: From Mendel's Peas to Designer Babies
Colin Tudge
67298 iGenetics:A Molecular Approach: International Edition Peter Russell 3ed
68837 Congenital Malformations: Evidence-Based Evaluation Praveen Kumar, Barbara
and Management
K. Burton
68868 HIGH YIELD GENETICS
PB
DUDEK
71265 Primer of Genetic Analysis
Thompson, Jr et al
72616 Oxford Handbook of Genetics, 1 Ed
Bradley-Smith, Guy; Hope, Sally; Firth, Helen V.;
73099 BRS GENETICS
PB
BRS (DUDEK)
73479 BRS Biochemistry, Molecular Biology, and Genetics, BRS (SWANSON) Fifth Edition
73981 World of the Cell, The:International Edition 7ed
Wayne Becker Lewis Kleinsmith Jeff Hardin Gregory
75615 USMLE Road Map: Genetics
Sack
77928 Medical Genetics,4 Ed
Lynn B. Jorde
80801 Statistics in Human Genetics and Molecular Biology (Chapman & Hall/CRC Texts in Statistical Science Series)
Reilly
82890 Human Molecular Genetics
Strachan
109773 Lewin's Genes X 10e International V
Krebs
112530 Biochemistry and Genetics: Pretest Self-Assessment Golder N. Wilson
2006 3775.00 2006 900.00
2007 6099.00 2007 5611.00
2005 2007 2007 2007
2875.00 3781.00 3049.00 4391.00
1341.00 2008 5489.00
2007 2004 2005 2009
4879.00 1404.00 15738.00 2490.00
2001 2214.00
2009 5489.00
2007 4879.00
2008 2007 2009
2379.00 3049.00 2875.00
2009 2678.00 2009 3044.00
2008 5476.00
2008 2009 2009
1463.00 5611.00 4757.00
2010 2010 2010
5978.00 6099.00 2561.00
26 od 116
and Review, Fourth Edition (PreTest Basic Science)
114132 Essentials of Genetics:International Edition 7ed
William Klug Michael Cummings Charlotte Spencer Mi
114362 Genetics For Dummies 2e
Robinson TR
114756 Schaum's Outline of Genetics, Fifth Edition (Schaum's Susan Elrod, William
Outline Series)
Stansfield
114834 Medical Genetics
Young, Ian D
114924 A Primer of Genome Science
Gibson G.; Muse S.
117268 Human Genetics, 9 Ed
Ricki Lewis
gerijatrija
1703 *sp* Reichel's Care of the Elderly
Gallo
1711 The Clinical Care of the Aged Person
21896 *sp* Primary Care Geriatrics: a Case Based Approach Ham, Richard J.
35848 *sp* The Cambridge Handbook of Age and Ageing
Johnson et al
40174 Encyclopedia of Gerontology, Two-Volume Set, 2nd James Birren edition
54191 Geriatric Rehabilitation Manual,
Timothy Kauffman
56778 GERIJATRIJA - medicina starije dobi
=LMDG'XUDNRYLьLVXUDGQLFL
72320 Oxford Handbook of Geriatric Medicine
Bowker
72347 Oxford Handbook of Nursing Older People
Tabernacle
74738 Essentials of Clinical Geriatrics: Sixth Edition
Robert L. Kane, Joseph G. Ouslander, Itamar B. Abr
116436 Savremena gerijatrija 2003
0ODGHQ'DYLGRYLь 'UDJRVODY0LORгHYLь Vladimir Ko
ginekologija i akuserstvo
11422 Doppler Ultrasound in Gynecology and Obstetrics
Christof Sohn
14307 Clinical Gynecologic Endocrinology and Infertility, 7 Ed SPEROFF
14540 Nazivlje u ginekologiji I porodnistvu
Ante Drazancic
14544 Ginekologija
9HOLPLUвLPXQLьLVXUDGQLFL
16147 *sp* European Practice in Gynaecology and Obstetrics Not Applicable (Na ) Invasive Carcinoma of the Cervix
16148 *sp* European Practice in Gynaecology and Obstetrics W. Kunzel Breech Delivery
17511 *sp* Obstetric and Gynecologic Emergencies: Diagnosis and Management
Mark D. Pearlman,Judith E. Tintinalli,Pamela L Dyn
17768 Surgical Techniques in Obstetrics and Gynaecology Darryl J. MaxwelliD. J. MAXWELL
17770 *sp* Hacker and Moore's Essentials of Obstetrics and Neville Hacker Gynecology, 4th edition
18339 Lecture Notes: Obstetrics and Gynaecology IE
Diana Hamilton-Fairley
18873 /LMHюHQMHUDNDMDMQLND
Damir Eljuga
18945 .URQLюQD]GMHOLюQDEROXеHQD
,YR-DMLь
19590 FETALNA EHOKARDIOGRAFIJA Prenatalna GLMDJQRVWLNDSULURGQLKVUюDQLKJUHгDND
Mladen Miljan
20086 Medical Complications in Pregnancy (Practical
Sabrina CraigoiEmily R
Pathways in Obstetrics & Gynecology Series) (Practical Baker
Pathways Obstetrics & Gynecology)
20555 Ultrasound in Obstetrics and Gynecology, Volume 1 - Merz, Eberhard Obstetrics, 2 Ed
20563 Color Doppler Sonography in Gynecology and Obstetrics
Schmidt, Werner O.
2009 3952.00
2010 1829.00 2010 1463.00
2010 2009 2009
3750.00 5733.00 5733.00
1999 2001 2005 2006
900.00 7003.00 1450.00 3965.00 55510.00
2007 2007 2006 2009 2009
5977.00 6300.00 2750.00 2375.00 4147.00
2003 864.00
2003 2004 2001 2001 2004
10692.00 15006.00 1332.00 8655.00 5806.00
2004 6221.00
2003 3565.00
2004 7075.00
2004 1450.00
2004 2003 1991
1647.00 2100.00 2100.00 546.00
2005 4269.00
2005 21595.00 2005 16195.00 27 od 116
21699 *sp* An Atlas of Reproductive Function
Jonathan Van Blerkom,Stefania A. Nottola,Tomonori
21735 Atlas of Gynecologic Oncology
J.Richard Smith,Guiseppe Del Priore,John Curtin,Jo
21736 Practical Obstetric Hematology
Ian A. GreeriPeter Clark
24296 *sp* A Clinical Guide for Contraception
SPEROFF
25208 The Bethesda System for Reporting Cervical Cytology, Solomon, Diane 2 Ed
25483 The Reproductive System At a Glance, 2 Ed -IE
Heffner
25966 *sp* Medical Disorders in Obstetric Practice
De Swiet
26078 Obstetrics and Gynecology,IE
Charles R.B. Beckmann
26609 GINEKOLOSKA ONKOLOGIJA
$QWHыRUXгLь'DPLU%DELь Mirko Samija, Hrvoje So
26898 Prenatal Diagnosis
Evans, Mark I.
27422 Osteoporosis in Focus
Neil Ferguson
30562 Handbook Obstetric Medicine 3e
Nelson/Piercy
34640 Pathology of the Human Placenta, 5 Ed
Kurt Benirschke, Peter Kaufmann, Rebecca N. Baerge
35531 Ultrasound in Obstetrics and Gynecology: Volume 2 - Eberhard Merz Gynecology
36084 NOVAKS GYNECOLOGY 14E
BEREK
36850 WILLIAMS OBSTETRICS STUDY GUIDE- ISE
Cox, Susan
37623 3HWNRYLьLVDUDGQLFL*LQHNRORJLMDXGеEHQLN]D specijalizante)
3HWNRYLьLVDUDGQLFL
39911 Gynaecology by Ten Teachers 18th Edition
Ash Monga
39912 Obstetrics by Ten Teachers
Clayton, Stanley G.
43281 Diagnostic Imaging: Breast,
Wendie A. Berg
43772 MANUAL OF OBSTETRICS 7E
EVANS
43876 Atlas of Gynecological Pathology
Tawfik, Ossama
43877 Clinical Studies in Obstetrics, Gynaecology and Women's Health
de Costa, Caroline M.
43964 Obstetric Ultrasound, 3rd edition
Trish Chudleigh
43968 Ultrasound in Gynecology, 2nd edition
Iian Timor-Tritsch
43974 Clinical Gynecology
Eric Bieber
43977 Clinical Gynecologic Oncology , 7th edition
Philip DiSaia
45102 Ultrasonography in Obstetrics and Gynecology, 5th edition
Peter Callen
47355 Gynecological Cytology
Hans Fr. Nauth
47467 Obstetrics and Gynecology
Azziz, Ricardo; Davis, Jane
47503 First Aid/Obstetrics & Gynecology Boards
Rahimian
48377 BLUEPRINTS OBSTETRICS & GYNECOLOGY 5E PB CALLAHAN
48558 ULTRAZVUK U GINEKOLOGIJI I PERINATOLOGIJI Asim Kurjak
48885 Atlas of Operative Laparoscopy and Hysteroscopy
Donnez
48904 Atlas of Lift-Laparoscopy: The New Concept of Gasless Kruschinski Laparoscopy
48915 Atlas of Urogynecological Endoscopy
48917 *sp* Male Reproductive Dysfunction Pathophysiology Kandeel Fouad R and Treatment
49007 Human Preimplantation Embryo Selection
Cohen
49413 Maternal-Fetal Medicine
D'alton/Norwitz/Mcelrath
2005 8540.00
2005 19520.00
2005 2005 2004
5489.00 2500.00 3850.00
2006 2002 2006 2005
1342.00 5795.00 2867.00 6300.00
2007 2004 2006 2006
10980.00 3837.00 4270.00 18138.00
2006 16195.00
2006 12993.00 2005 1829.00 2004 2700.00
2006 2006 2006 2007 2007 2007
2439.00 2439.00 22936.00 3233.00 7685.00 2317.00
2004 2006 2006 2007 2007
5245.00 12566.00 12444.00 14396.00 10613.00
2007 2007 2007 2009 2007 2007 2007
17275.00 2989.00 3837.00 2684.00 12600.00 21838.00 15250.00
2006 12078.00 2007 18666.00
2007 17690.00 2007 3660.00 28 od 116
49477 Obstetric Anesthesia
Pian-Smith/Leffler
49536 Drugs During Pregnancy and Lactation, 2nd edition Christof Schaefer
49641 Obstetrics and Gynecology, 2 Ed (Case Files)
Eugene C. Toy, Benton Baker, etc.
51800 Diagnostic Imaging: Gynecology
Hedvig Hricak
55720 Urgentna opstetricija
дLYDQRYLьдHOMNR
56144 DANFORTHS OBSTETRICS & GYNECOLOGY 10E GIBBS CB
56145 TeLinde's Operative Gynecology
ROCK
56217 DRUGS IN PREGNANCY & LACTATION 8E CB BRIGGS
57064 VAGINAL SURGERY
CB
KOVAC
58834 William's Gynecology
John O Schorge, Gary Cunningham, Barbara Hoffman
59753 Creasy and Resnik's Maternal-Fetal Medicine: Principles and Practice, 6th Edition Expert Consult: Print Online with Updates
Creasy, Resnik, Iams, Lockwood & Moore
59848 Oxford Handbook of Obstetrics and Gynaecology (2/e) Collins, Sally; Arulkumaran, Sabaratnam; Hayes, Ke
59851 Oxford Handbook of Reproductive Medicine & Family McVeigh, Enda; Homburg,
Planning
Roy; Guillebaud, John
59913 Ultrasound of Fetal Syndromes: Text with DVD
Beryl R. Benacerraf
59922 Atlas of Gynecologic Surgical Pathology (Atlas Of...) Philip B. Clement, Robert H. Young
59944 Fetal Medicine: Basic Science and Clinical Practice
Charles H. Rodeck, Martin J. Whittle
59981 Early Diagnosis and Treatment of Cancer Series: Breast Cancer (Early Diagnosis in Cancer)
Lisa Jacobs, Christina Finlayson
60010 Breast Imaging (DX-Direct Series)
U. Fischer, F. Baum, S. Luftner-Nagel
61070 Obstetric Anaesthesia
Clyburn, Paul; Collis, Rachel; Harries, Sarah; Dav
61130 100 Cases in Obstetrics and Gynaecology
Cecilia Bottomley
61135 Overcoming Postnatal Depression: a Five Areas Approach
Dr. Christopher Williams
61364 William's Manual of Obstetrics: Pregnancy Complications, 22 Ed-ISE
LEVENO
61722 'LMDJQRVWLNDLOHюHQMHREROMHQMDFHUYLNVDYDJLQHLYXOYH 6WDQLPLURYLь%UDQNR Kolposkopski atlas
61738 Asistirana reproduktivna tehnologija u humanoj reprodukciji
5DGXORYLь6ORERGDQ5 autor
61956 .OLQLюNDUHSURGXNWLYQDHQGRNULQRORJLMD
*RUGDQD03UHOHYLь
61994 Atlas radikalnih operacija u ginekologiji : ilustrovano sa 3RюHNRYDF3HWDUDXWRU 130 originalnih kolor fotografija i 319 crteza
62035 Drugs and Pregnancy: a handbook
Little, Bertis
62044 Health Promotion in Midwifery 2nd Edition: Principles Jan Bowden and practice
62046 Women's Vascular Health
Ian a Greer
63188 Obstetrics and Gynaecology 3e
Impey L
63678 Contraception: Your Questions Answered,
John Guillebaud
65879 Osnovi ginekoloske dijagnostike
5DGRYLь3HWDUDXWRU
65880 Infekcije - oboljenja i dijagnostika donjeg dela genitalnog sistema zene
3RSRYLь'XгDQDXWRU
65882 Reproduktivna endokrinologija : regulacija ovarijalnog i 'UDJRMHYLь'LNLь6YHWODQD
2007 2007 2006
3660.00 4391.00 1842.00
2007 22936.00 2003 879.00 2008 13420.00
2008 2008 2007 2008
14518.00 10492.00 13054.00 12077.00
2008 16348.00
2008 2500.00
2008 2500.00
2007 15738.00 2008 20496.00
2008 26352.00
2008 11398.00
2007 4855.00
2008 5371.00
2008 2439.00 2008 2805.00
2007 2073.00
2006 4536.00
2007 3780.00
1996 1080.00 2003 2700.00
2006 3659.00 2006 2439.00
2006 2008 2008 2003 2007
12078.00 4147.00 4147.00 648.00 432.00
2001 1296.00 29 od 116
menstrualnog ciklusa, indukcija ovulacije 66265 Essentials of Obstetrics & Gynecology 5e SC IE 68527 Oxford Handbook of Women's Health Nursing, 1 Ed 68804 Williams Obstetrics, 23 Ed 68805 Laparoscopic Surgery for Gynecologic Oncology 68807 Case Files Gynecologic Surgery (Lange Case Files) 68846 Fetal and Neonatal Brain Injury, 4 Ed 68852 Fetal Echocardiography 68858 A Practical Guide to Basic Laboratory Andrology 68959 Lecture Notes - Obstetric and Gynaecology 3e 68960 Fetal Cardiology 69023 Gynecologic Pathology, 69312 Obstetrics and Gynecology Board Review 3ed ISE 69596 3252'1,э.(23(5$&,-( 69775 Urinarna inkontinencija 69783 Mjesto i uloga kolposkopije u ranoj dijagnozi 70089 $OJRULWPLVDYUHPHQHGLMDJQRVWLNHLOHюHQMDLQIHNWLYQLK EROHVWLXWUXGQRьL 70099 Humana reprodukcija 70103 3UDNWLюQDJLQHNRORJLMD 70896 Obstetrics & Gynecology: PreTest Self-Assessment & Review 12ed ISE
Hacker Gupta, Sunanda; Holloway, Debra; Kubba, Ali F. Cunningham, Kenneth Leveno, Steven Bloom Allan L. Covens, Rachel Kupets Eugene C. Toy, Cristo Papasakelariou, Konrad P. Ha Stevenson et al Allan/Cook/Huggon Bjorndahl et al Hamilton-Fairle D Archer, Nick; Manning, Nicky Marisa Nucci Somkuti Dubravko Habek i suradnici 7LKRPLU59HMQRYLь-RYDQ %+DGеLRNLь *RUDQ*UXELгLь1LNROD /MXERMHYLь %UNLь6QHеDQDDXWRU %RMRYLь6DYRDXWRU 5LVWLь/-XERPLUDXWRU L]GDYDю SCHNEIDER
2009 3825.00 2009 2375.00 2009 11590.00 2009 11590.00 2009 2439.00
2009 2009 2009 2008 2009
11590.00 11590.00 4270.00 2805.00 4370.00
2009 2009 2009 2009
13542.00 3367.00 5320.00 2808.00
2004 1540.00
2009 972.00
2003 2160.00 2006 1728.00
2009 1951.00
71137 Myles Textbook for Midwives, International Edition, 15th Edition
Fraser & Cooper
2009 2185.00
71290 Obstetrics Illustrated 7th IE
Hanretty
2009 2595.00
71306 Clinical Obstetrics & Gyneacology 2ed IE
Magowan
2009 2185.00
71698 Cytology, 71861 Ultrasound in Obstetrics and Gynaecology Book and CD-ROM
Edmund S. Cibas Juiry W. Wladimiroff
2009 14640.00 2009 6343.00
72279 Oxford Handbook of Midwifery
Medforth
72395 Plastic and Reconstrutive Surgery of the Breast: A Surgical Atlas
Christian J. Gabka, Heinz Bohmert, Philip Blondeel
72433 Yen & Jaffe's Reproductive Endocrinology , 6th Edition Jerome F. Strauss Expert Consult - Online and Print
73101 Principles and Practice of Gynecologic Oncology, 5 Ed BARAKAT
73135 MATERNAL NEONATAL CARE MIE UK EDITION PB NURSE
73323 Case Files: Obstetrics and Gynecology, 3 Ed -ISE
Toy
2006 2250.00 2008 19435.00 2009 18910.00 2009 18666.00 2009 2678.00 2009 1732.00
73589 Berek and Hacker's Gynecologic Oncology 5e
BEREK, HACKER
2009 13786.00
30 od 116
74201 Oxford Handbook of Obstetrics and Gynaecology 2nd Edition and Emergencies in Obstetrics and Gynaecology Pack 74778 State-of-the-Art Vaginal Surgery 74809 Step-by-Step Colposcopy, Cryosurgery, and LEEP 75669 Ginekologija i akuserstvo 76746 Gynecological Endoscopy Simplified: Practical Tips by Experts 77126 PORODNISTVO 79732 Drugs for Pregnant and Lactating Women, 79734 Hysteroscopy: Office Evaluation and Management of the Uterine Cavity, 81221 Sperm Banking 81222 Manual of Intrauterine Insemination and Ovulation Induction 81223 Infertility in the Male 81249 Ultrasonography in Reproductive Medicine and Infertility 81294 environmental impacts on Reproductive Health and Fertility 81357 Llewellyn-Jones Fundamentals of Obstetrics and Gynaecology International Edition, 9th Edition
Arulkumaran, Sabaratnam; Impey, Lawrence; Hayes, K Neerja Goel B Shakuntala Baliga 0ODGHQRYLь'UDJRPLU autor Sunita Tandulwadkar ,YDQ.XYDюLь$VLP.XUMDN -RVLSHOPLгLVXUDGQLF Carl P. Weiner Linda D. Bradley Pacey/Tomlinson Dickey/Brinsden/Pyrzak Lipshultz/Howards/Niederb Rizk Woodruff et al Oats & Abraham
2008 4996.00 2009 15249.00 2009 4635.00 2008 1307.00 2009 4635.00 2009 6552.00 2009 10735.00 2008 12322.00 2009 4270.00 2009 4636.00 2009 15860.00 2010 12200.00 2010 8540.00 2010 2458.00
81987 HANDBOOK OBS GYN EMERGENCIES 3E PB BENRUBI
82003 Handbook for Principles and Practice of Gynecologic LEVINE Oncology
82094 Step by Step Ultrasound in Obstetrics
Singh
82275 Ginekoloska onkologija
6UGMDQ'MXUGMHYLьL9HVQD .HVDLь
108938 Basic Science in Obstetrics and Gynaecology,
Phillip Bennett
109688 MANUAL GYNECOLOGY OBSTET 4E (INT ED) PB JOHN HOPKINS
110202 Oxford Handbook of Genitourinary Medicine, HIV, and Sankar, Nathan; Pattman,
Sexual Health
Richard; Handy, Pauline;
110356 CLINICAL GUIDE FOR CONTRACEPTION 5E PB SPEROFF
110418 вWLWDVWDеOH]GDLWUXGQRьD
9RMYRGLь/-LOMDQD%
110419 $WODVSRURяDM
3RюHNRYDF3HWDU
110420 Fetalni forceps ekstraktor : monografija
)ROLь0LURVODYDXWRU
110421 Atlas ginekoloske sonografije
5DGXQRYLь1HERMгD
110520 Ginekolosko akuserski leksikon
1LQNRYLь5DGRVODYDXWRU
110922 Ginekolosko-akuserski leksikon
1LQNRYLь5DGRVODYDXWRU
111082 Gynaecology, 4th Edition Expert Consult: Online and Print
Robert W. Shaw
111650 Urologic Surgery for the Gynecologist and Urogynecologist,
John B. Gebhart
111703 Diagnostic Gynecologic and Obstetric Pathology,2ed Christopher P. Crum
111714 Fanaroff and Martin's Neonatal-Perinatal Medicine, 9th Richard J. Martin Edition, Diseases of the Fetus and Infant (Expert Consult - Online and Print) (2-Volume Set)
111865 Savremena ginekologija
'LQXORYLь'XгDQDXWRU L]GDYDю
112158 Avoiding Common Errors in Obstetrics and Gynecology ROBERTS
112159 Breast Pathology: Diagnosis by Needle Core Biopsy, ROSEN
2005 5734.00 2010 3166.00
2010 3109.00 2009 5400.00
2010 2010 2010
5733.00 4630.00 3495.00
2010 1999 1998 2002 1991 2000 2006 2010
5612.00 1296.00 756.00 324.00 432.00 486.00 653.00 20130.00
2010 10247.00
2010 21960.00 2010 22082.00
2006 8640.00 2010 3843.00 2010 15982.00 31 od 116
3e
112431 Sonography in Obstetrics & Gynecology: Principles and Fleischer ; F; Jeanty Practice
112432 Obstetric Intensive Care Manual, Third Edition
Michael R. Foley, Jr., Thomas H. Strong, Thomas J
113389 Fetal Radiology: A Diagnostic Atlas
Reinhard Schumacher, Laurie H. Seaver, Jьrgen Spra
113436 Gestational Diabetes During and After Pregnancy
113447 Atlas of Endometrial Histopathology
Gisela Dallenbach-Hellweg, Dietmar Schmidt, Friede
114483 High Risk Pregnancy,4 Ed
David James
114695 Handbook of Obstetric Medicine, Fourth Edition
C Nelson-Piercy
114740 VULVO-VAGINAL INFECTIONS
PB
LEDGER
115219 100 Q&as About Infertility 2e
Gordon
115220 Dx/Rx: Sexual Dysfunction in Men and Women
Zaslau
115225 Dx/Rx: Gynecologic Cancer
Dizon
115477 Guide de consultation prйnatale
B. Parmentier, F. Debiиve, Pierre Delvoye
115482 120 questions en gynйcologie-obstйtrique
Henri Marret, Jacques Wagner-Ballon, H Guyot
115911 3DWRORJLMDWUXGQRьH
1LQNRYLь5DGRVODYDXWRU
116016 Obstetrics and Gynecology at a Glance 3e
Norwitz E
116017 Donald School Ultrasound in Obstetrics and Gynecology
Badreldeen Ahmed
116134 EXAM PREP ULTRASOUND ABDOMEN OBS GYN PENNY PB
117562 The Netter Collection of Medical Illustrations: Reproductive System,1
Roger P. Smith
118788 The Placenta and Human Developmental Programming Burton et al
119325 First Aid for the Obstetrics and Gynecology Clerkship, Matthew S. Kaufman, Latha
Third Edition (First Aid Series)
Ganti Stead, Jeane Simmo
119621 Infections, Infertility, and Assisted Reproduction
Elder/Baker/Ribes
119628 Hypertension in Pregnancy
Heazell et al
119629 Handbook of Fetal Medicine
Kumar
119870 Imunobiologija genitalnog trakta zena : karakteristike Kataranovski, Milena - autor LPXQVNRJVLVWHPDL]QDюDMXRGEUDQLRGLQIHNFLMD
120082 Atlas kongenitalnih anomalija i oboljenja spoljasnjih genitalija u razvojnom dobu
'REDQRYDюNL'XгDQND autor - fotograf
hematologija
165 Bone Marrow Transplantation 2 Ed
Shaefer
7233 Haematology & Oncology- IE
RCP
8547 Pocket Atlas of Hematology: Practical Microscopic and Theml Clinical Diagnosis, 2 Ed
18815 Hematologija i transfuziologija
-DNгLь/DEDU*UJLюHYLь
18824 Transfuzijska medicina
*UJLюHYLь
18908 Hematologija
0LUD3UHPXеLь/
20718 *sp* Interactions of Blood and the Pulmonary Circulation (American Heart Association Monograph Series.)
E. Kenneth Weir,Helen L. Reeve,John T. Reeves
24817 Haematology at a Glance (At a Glance S.),IE
Victor HoffbrandiAtul B. Mehta
2011 14761.00 2010 11589.00
2011 11334.00
2010 8499.00 2010 14736.00
2010 2010 2010 2010 2010 2010 2009
15738.00 6100.00 3654.00 1585.00 3171.00 1951.00 5265.00
2009 5264.00
2003 2010 2009
756.00 2683.00 7685.00
2010 5734.00
2010 7807.00
2010 7320.00 2011 1818.00
2011 2010 2010 2011
4270.00 4270.00 3659.00 1620.00
2007 756.00
1996 2003 2004
2560.00 2440.00 3775.00
1989 1995 2000 2002
3176.00 2160.00 2380.00 900.00
2005 1342.00 32 od 116
32097 75$16)8=,-6.$0(',&,1$8./,1,э.2-35$.6, 32125 Transfuziologija 36241 Clinical Hematology 37820 6,'(523(1,э1$$1(0,-$ 39733 *sp* WINTROBES CLIN ATLAS HEMATOLOGY 43920 Abc of Clinical Haematology 43950 HANDBK CANCER CHEMOTHERAPY 7E 47212 *sp* Atlas of Differential Diagnosis in Neoplastic Hematology 55146 Hematology, 5th Edition Basic Principles and Practice (Expert Consult: Online and Print) 55721 Maligne bolesti krvi 59893 Haematology: An Illustrated Colour Text 59934 Color Atlas of Clinical Hematology, 4th Edition Expert Consult - Online and Print
'DPLU*UJLюHYLь Balint Bela Neal Young 6UяDQDэXOLь0HOLWD1DNLьL Igor Auer TKACHUK Provan SKEEL Gorczyca Ronald Hoffman 0LOLFD'эRORYLь Martin R. Howard, Peter J. Hamilton A. Victor Hoffbrand
2006 2004 2006 2006
4200.00 1604.00 16714.00 1400.00
2006 0 2007 2004
9138.00 3049.00 3416.00 11590.00
2008 22448.00
1999 1298.00 2007 3415.00
2009 17202.00
61050 Oxford Handbook of Clinical Haematology, 3 Ed
Drew Provan, Charles R J Singer, Trevor Baglin
63646 Hematologija
Boris Labar,
66474 The Washington Manual Hematology and Oncology WASHINGTON UNIV Subspecialty Consult The Washington Manual Hematology and Oncology Subspecialty Consult, 2 Ed
66503 Quick Guide to Coagulation Testing
Marisa B. Marques, George A. Fritsma
73012 Atlas of Clinical Hematology, 2 Ed
Armitage, James
73098 BETHESDA HANDBK CLINICAL HEAMATOL 2E PB RODGERS
73124 BETHESDA HANDBK CLINICAL ONCOLOGY 3E PB ABRAHAM
73150 Wintrobe's Clinical Hematology,2 vol. set
GREER
2009 3125.00 2007 4847.00 2008 2867.00
2006 2214.00
2008 2009 2009 2008
11334.00 4026.00 3050.00 24278.00
81254 The Obstetric Hematology Manual 82117 Harrison's Hematology and Oncology 82780 IMMUNOHEMATOLOGY PRIN PRACT 3E CB 110533 'LMDJQRVWLюNHGLOHPHXKHPDWRORJLMLGLMDJQRVWLюNH GLOHPHNOLQLюNLKVLQGURPDUDFLRQDOQDGLMDJQRVWLND UHгDYDQMHGLMDJQRVWLюNLKGLOHPD 110872 Laboratorijska hematologija : za studente farmacije 112366 HEMATOLOGY IN CLINICAL PRACTICE
Pavord/Hunt Longo QUINLEY 9XNXгLь=YRQLPLUDXWRU 0LUROMXE93HWURYLь HILLMAN
2010 2010 2010 2009
6100.00 6343.00 4752.00 432.00
2009 972.00 2010 3489.00
119871 +HPLRWHUDSLMVNLSULUXюQLN hirurgija 173 *sp* Handbook of Endovascular Surgery 175 *sp* Crucial Controversies in Surgery 1998 851 *sp* Clinical Surgery in General 3 Ed 16168 *sp* Atlas of Vascular Surgery 19594 6895(0(12.,585в.2/,-(э(1-(78025$ HIPOFIZE 20128 Surgery Review Illustrated 23632 *sp* Vascular Surgery,6 Ed
0DUMDQRYLь6ORERGDQ autor Ahn, Obrand Schein Kirk Christopher K. ZarinsiBruce L. Gewertz дLYNR*QMLGLьLVXUDGQLFL Amit D. Tevar,Rafael Azuaje,Lawrence Micon,Lawre Robert Rutherford
2010 1620.00
1997 1998 2000 2005
350.00 400.00 1450.00 11163.00
2004 2100.00
2004 4391.00
2005 20411.00 33 od 116
23632 *sp* Vascular Surgery,6 Ed
Robert Rutherford
26089 HIGH-YIELD SURGERY 2E- IE
NIRULA
26432 *sp* Pediatric Surgery, 4th edition
Ashcraft
26617 ABC KIRURSKE SVAKIDASNJICE
-DQNR+DQюHYLьLVXUDGQLFL
27859 6-(ы$1-$-('12*.,585*$
Mladen Stulhofer
31522 KIRURGIJA ZA MEDICINARE
353,ы,685$'1,&,
34626 Oxford Handbook of ENT and Head and Neck Surgery Corbridge, Rogan; Steventon, Nicholas
34756 Churchill's Pocketbook of Surgery 3E - IE
Raftery
35736 *sp* Vitreous Microsurgery, 4 Edition
CHARLES
35905 SURGERY OF THE BREAST 2E 2-VOL
SPEAR
36844 Current Surgical Diagnosis and Treatment-ISE
Doherty, Gerard M.
37814 ABC KIRURSKE SVAKIDASNJICE 2. dio
-DQNR+DQюHYLьLVXUDGQLFL
39444 Kompendij neurokirurgije
Josip Paladino
39620 *sp* COMPLEX & REVISION PROBLEMS IN SHOULDER SURGERY 2E
WARNER
39627 *sp* COMPLICATIONS IN SURGERY
MULHOLLAND
39749 *sp* TEXT MED SURGICAL NURSING 11E (2
SMELTZER
42162 HIRURGIJA ZA STUDENTE I LEKARE
'UDJRVODY06WHYRYLь
43657 Principles and Practice of Surgery 5e- IE
Garden
43789 ADVANCED SURGICAL RECALL 3E
BLACKBOURNE
43991 Medicine & Surgery an Integrated Textbook
Lim
43993 Essential Surgery International Edition, 4th Edition
Burkitt
Problems, Diagnosis and Management With STUDENT
CONSULT Online Access
47366 *sp* Surgical Ultrasound
Rene Mantke
47456 The Physiologic Basis of Surgery
J.Patrick O'Leary, Arnold Tabuenca
47504 Sabiston'sTextbook of Surgery 18/e IE
Townsend
47514 First Exposure to General Surgery ISE
Danny Jacobs
47863 Medicolegal Reporting in Surgery
Jones, Barry J. Jones
48324 Medical Devices: Use and Safety
Bertil Jacobson
48379 Pediatrics (Master Techniques in Orthopaedic Surgery) Vernon T Tolo
48887 Minimally Invasive Shoulder and Elbow Surgery
Levine William N
48904 Atlas of Lift-Laparoscopy: The New Concept of Gasless Kruschinski Laparoscopy
49932 Kirurgija, 1222 str.
Tomislav Sosa, Zeljko 6XWOLь=GHQNR6WDQHF
50095 NEUROKIRURGIJA
9ODGLPLU-вLPXQRYLь
51730 Underground Clinical Vignettes Step 2: Surgery (Underground Clinical Vignettes: Step 2): Surgery (Underground Clinical Vignettes: Step 2)
Sandra I. Kim, Todd A. Swanson
53192 Pearson's Thoracic and Esophageal Surgery,
G. Alexander Patterson
54584 Thoracic Surgery Atlas
Mark Ferguson
55706 +LUXUJLMDRюQHGXSOMH
55712 Hirurgija tiroidne i paratiroidnih zlezda
5DGRYDQ-DQNRYLь
55715 Komplikacije u digestivnoj hirurgiji
=RUDQ%*HU]Lь
55726 Osnovi neurohirurgije
0LURVODY6DPDUGеLь
55729 Hirurgija pankreasa
5DGRMH%эRORYLь
55738 Hirurgija bilijarnog trakta
5DGRMH%эRORYLь
55739 Venski tromboembolizam u hirurgiji
56573 Illustrated Lecture Notes in Oral and Maxillofacial
George Dimitroulis
2005 2005 2005 2005 2004 2005 2006
20411.00 1281.00 17385.00 4900.00 1750.00 3197.00 3120.00
2006 2006 2005 2006 2006 2004 2005
1638.00 5500.00 26230.00 3044.00 4900.00 1776.00 5551.00
2005 2007 2000 2007 2007 2007 2007
5246.00 1800.00 3456.00 3005.00 2379.00 6694.00 3141.00
2006 13766.00 2007 9760.00
2007 2006 1997 2006 2007 2007 2007
9837.00 1574.00 11402.00 3415.00 14518.00 28060.00 15250.00
2007 11761.00
2007 5180.00 2007 1525.00
2008 2007 2001 2000 1998 1998 1998 2000 2008
31476.00 16958.00 1164.00 909.00 1947.00 584.00 584.00 519.00 535.00 13176.00
34 od 116
Surgery
56870 KIRURGIJA DOJKE
MRVLSIDMGLьLYRGеHSLQD
57991 ABC kirurske svakidasnjice 3. dio
-DQNR+DQюHYLьLVXUDGQLFL
59917 Surgical Techniques in Ophthalmology Series: Glaucoma Surgery: Text with DVD (Surgical Techniques in Ophthalmology)
Teresa C. Chen
59960 Atlas of Minimally Invasive Surgery with DVD
Constantine T. Frantzides, Mark A. Carlson
59991 Neurosurgery Practice Questions and Answers
Mark Shaya, Remi Nader, Anil Nanda
59994 Operative Neurosurgical Anatomy
Damirez Fossett, Anthony J. Caputy
60001 Neurosurgical Intensive Care: The Essentials
Javed Siddiqi
60140 Advanced Laparoscopic Surgery: Techniques and Tips Namir Katkhouda
60189 Fundamentals Of Orthognathic Surgery, 2 Ed
Malcolm Harris
60729 CLINICAL NEUROSURGERY VOL 54
CB
MCKHANN
60763 Atlas of Laparoscopic Urologic Surgery (Atlas Of...)
Serdar Deger, Jan Roigas, Robert G. Moore
61046 Oxford Handbook of Clinical Surgery (3/e)
McLatchie, Greg; Borley, Neil; Chikwe, Joanna
61061 Otolaryngology and Head and Neck Surgery
Warner, Giles; Corbridge, Rogan; Martinez-Devesa,
61063 Urological Surgery (Oxford Specialist Handbooks in Surgery)
Reynard, John; Turner, Kevin; Mark, Stephen; Armen
62010 Operative Thoracic Surgery 5 Ed
Kaiser
62054 Operative Endoscopy and Endoscopic Surgery in Infants and Children
Najmaldin, a
62056 Surgery Minitext
Lumley et al
62098 Hirurgija raka dojke
'дRGLь5DGDQDXWRU
62129 +LUXUJLMDRюQHGXSOMH
5RQюHYLь5DGPLOR3 autor
63018 Sternberg's Diagnostic Surgical Pathology, 5 Ed
MILLS
63663 Dermatologic Surgery,
Allison Vidimos
65974 Urinarne derivacije
-RYDQ%+DGеLRNLь
68936 Surgical Exposures in Orthopaedics: The Anatomic Approach, 4 Ed
HOPPENFELD
69212 Abernathy's Surgical Secrets,
Alden Harken
69598 POVIJEST KIRURGIJE
9LOMDP%LOLь
70834 First Aid for the Surgery Clerkship 2ed ISE
KAUFMAN
2006 2479.00 2008 3500.00 2007 11589.00
2008 15738.00
2005 1939.00
2002 10795.00
2008 2008 2008 2007 2007
6475.00 17134.00 7906.00 6832.00 10370.00
2007 2750.00
2008 5371.00
2008 5315.00
2006 25010.00 2005 21838.00
2004 2005 2003
2561.00 2484.00 1164.00
2009 2008 2009 2009
34892.00 7929.00 2808.00 18666.00
2008 2009 2009
4025.00 2800.00 1707.00
71665 Companion to Specialist Surgical Practice Package, 4th Edition 8-Volume Set
Simon Paterson-Brown
2009 60878.00
71824 Hinman's Atlas Of Pediatric Urologic Surgery, 2nd Edition
Frank Hinman
2008 25132.00
71831 Gowned and Gloved Surgery: Introduction to Common Robert E. Roses Procedures,
72442 Clinical Research for Surgeons
Mohit Bhandari, Anders Joensson
72443 Surgery of Peripheral Nerves: A Case-based Approach Rajiv Midha, Eric I. Zager
72450 Intracranial Sterotactic Radiosurgery
2009 3171.00 2009 9715.00 2008 10795.00 2009 16195.00 35 od 116
72457 Functional Neurosurgery (Neurosurgical Operative Atlas)
Phillip A. Starr, Nicholas M. Barbaro, Paul S. Lar
72479 An Illustrated Handbook of Flap-Raising Techniques Kartik G. Krishnan
72570 Sabiston and Spencer's Surgery of the Chest, 8th Ed -2 Frank Sellke -Volume Set, Expert Consult -Online and Print
2008 23755.00 2008 8635.00 2010 26230.00
72990 Comprehensive Vascular and Endovascular Surgery Hallett, John W.
73328 Case Files: Surgery, 3 Ed -ISE
Toy
2009 20618.00 2009 1732.00
74199 Oxford Handbook of ENT and Head and Neck Surgery Corbridge, Rogan;
(2/e)
Steventon, Nicholas
74212 Liver and Pancreatobiliary Surgery
Sutcliffe, Robert; Antoniades, Charalambos Gustav;
74226 Surgical Oncology
Chaudry, M Asif; Winslet, Marc Christopher
74376 Paediatric Surgery
Davenport, Mark; Pierro, Agostino
74388 Perioperative Medicine (2/e)
Chikwe, Joanna; Walther, Axel; Jones, Phil
74778 State-of-the-Art Vaginal Surgery
Neerja Goel
74787 Atlas of Cataract Surgery
K Ravi Kumar Reddy, P. Satyavani
74808 McGraw-Hill Manual Colorectal Surgery
Andreas M. Kaiser
74809 Step-by-Step Colposcopy, Cryosurgery, and LEEP
B Shakuntala Baliga
74862 Schwartz's Principles of Surgery, 9 Ed
F. Charles Brunicardi, Dana K. Andersen, Timothy R
74984 Operative Oral and Maxillofacial Surgery 2ed
John Langdon
75868 Hirurgija katarakte
%DERYLь6LQLгD
76023 Current Diagnosis and Treatment: Surgery 13e -ISE Doherty (LANGE series)
76227 OTORINOLARINGOLOGIJA I KIRURGIJA GLAVE I 9ODGLPLU.DWLь'UDJR
VRATA
Prgomet i suradnici
76316 Hirurgija ramena
'LNOLь,YDQDXWRU
76743 McGraw-Hill Manual Endocrine Surgery
Shane Y. Morita, Alan P. B. Dackiw, Martha A. Zei
77940 Colorectal Surgery,
Robin K. S. Phillips
80939 Abdominalna hirurgija : pitanjanja i odgovori
6HNXOLь6WRMDQ'DXWRU
81017 Post-operative Complications (2/e)
Leaper, David; Whitaker, Iain
81018 Renal Transplantation
Torpey, Nicholas; Moghal, Nadeem E; Watson, Evelyn
81029 Atlas of Cardiac Surgical Techniques,
Frank Sellke
81031 Carpentier's Reconstructive Valve Surgery,
Alain Carpentier
81204 Ashcraft's Pediatric Surgery,5 Ed
George W. Holcomb
81243 Plastic Surgery Secrets Plus,2ed
Jeffrey Weinzweig
81355 Basic Surgical Techniques International Edition, 6th Kirk Edition
2009 2875.00 2009 4996.00
2009 5621.00
2009 5621.00
2009 4370.00
2009 15249.00 2009 11711.00
2009 5001.00 2009 4635.00 2009 12200.00
2010 26840.00 2009 1836.00 2009 4269.00
2009 4428.00
2009 6156.00 2009 6343.00
2009 2006 2010
9149.00 5400.00 4370.00
2010 4996.00
2009 2010 2010 2010 2010
20496.00 15250.00 23546.00 4269.00 2185.00
82417 Handbook of Pediatric Surgery 82426 Illustrative Handbook of General Surgery 82428 Colorectal Surgery: Living Pathology in the Operating Room 109947 KIRURSKA PROPEDEUTIKA, FIZIKALNI ZNAKOVI
Herbert Chen Mark Killingback 0DWLMD+RUеLь
2010 2009 2010
6399.00 5664.00 8576.00
2010 7700.00 36 od 116
110346 Hand Surgery
Warwick, David; Dunn, Roderick; Melikyan, Erman; V
110826 +LWQDVWDQMDXQHXURKLUXUJLMLGLMDJQRVWLюNRWHUDSLMVNL 0LURVODY6DPDUGеLь YRGLю
111562 Reconstructive Foot and Ankle Surgery: Management Mark S. Myerson of Complications ,2ed
111588 Endovascular Surgery,
Wesley S. Moore
111593 Atlas of Thoracic Surgical Techniques,
Joseph B. Zwischenberger
111644 Minimally Invasive Percutaneous Spinal Techniques, Daniel H. Kim
112160 SURGERY OF THE BREAST 3E
CB
SPEAR
112257 Textbook of Surgery 3e
Tjandra JJ
112434 Kuerer's Breast Surgical Oncology
Henry Kuerer
112507 Lange Current Procedures: Surgery
Gerard M. Doherty
112643 TEXT MED SURG NURS 12E H/BK (INT ED) PB
SMELTZER
112931 Aana Advanced Arthroscopy: The Wrist and Elbow, Felix H. Savoie
113210 Heart Valve Surgery: An Illustrated Guide
Jan Dominik, Pavel Zacek
113425 Rapid Surgery 2e
Baker CR
113761 Modern Surgical Neuropathology with Cd-Rom
Miller
113944 Colorectal Surgery ()
MacKay, Graham J; Dorrance, Helen R; Molloy, Richa
114572 Surgical Instruments,
Maryann Papanier Wells
115353 DEZINFEKCIJA, STERILIZACIJA I SKLADISTENJE FLEKSIBILNIH ENDOSKOPA I ENDOSKOPSKOG PRIBORA
-%UOMDN53XODQLь5 2VWRMLь6.DOHQLь
115424 Surgical Management of Spinal Deformities: Expert Thomas J. Errico Consult: Online and Print (Expert Consult Title: Online + Print)
115452 Zollinger's Atlas of Surgical Operations 9e ISE
Zollinger
115912 Barrett-ov jednjak : sezdeset godina kontroverze
Pesko, Predrag - autor
116053 Pelvic Floor Disorders for the Colorectal Surgeon
Lindsey, Ian; Nugent, Karen; Dixon, Tony
116140 Vascular and Endovascular Surgery,
Jonathan D. Beard
116661 Atlas of General Surgery
Volker Schumpelick
117222 TRANSPLANT INFECTIONS 3E
CB
BOWDEN
117233 Greenfield's Surgery: Scientific Principles & Practice, 5 MULHOLLAND Ed
117452 ADVANCE SURGICAL PATH LUNG CANCER CB CAGLE
118437 Churchill's Pocketbook of Surgery, International Edition, Raftery, Delbridge &
4th Edition
Wagstaff
118504 Ambulantna hirurgija
'UDJRYLь0LODQDXWRU ilustrator
118526 Medical Surgical Nursing Single Vol 8ed
Lewis
118792 Postgraduate Vascular Surgery
Bhattacharya/Stansby
histologija i embriologija
986 An Atlas of Histology
Zhang
6629 Color Atlas of Embryology
Drews
6633 Pocket Atlas of Cytology, Histology and Microscopic Kuehnel Anatomy, 4th edition
24615 Osnovi histologije, 11. edicija
Luiz Carlos Junqueira, Jose Carneiro
24923 *sp* Quality and Risk Management in the IVF
Mortimer/Mortimer
2009 6246.00
2010 1620.00
2010 18056.00
2010 2010 2010 2010 2005 2010 2010 2010 2010 2010 2010 2009 2010
19642.00 19642.00 13054.00 40016.00 6099.00 18787.00 7503.00 3233.00 18056.00 18138.00 2317.00 15860.00 5371.00
2010 3659.00 2010 840.00
2008 19642.00
2010 15493.00 2010 2160.00 2010 6246.00
2009 2009 2010 2010
9149.00 14035.00 16470.00 15982.00
2010 10370.00 2011 1463.00
2006 1112.00
2011 4147.00 2011 4636.00
1999 1996 2003
7932.00 3775.00 3775.00
2005 2490.00
2004 900.00 37 od 116
Laboratory
29615 Essentials of Oral Histology and Embryology, 3rd edition, 3rd Edition
30561 Wheater's Functional Histology 5e
35727 *sp* HIGH-YIELD EMBRYOLOGY 3E
PB
36215 Netter's Atlas of Human Embryology-IE
36224 Color Textbook of Histology , 3rd edition With STUDENT CONSULT Online Access
36669 BASIC HISTOLOGY: TEXT & ATLAS, 11 Ed - ISE
43783 *sp* BRS: EMBRYOLOGY 4ED
Avery DUDEK Cochard Leslie Gartner JUNQUEIRA Ronald W Dudek
2006 5489.00
2006 2006 2002 2006
2458.00 600.00 2731.00 6099.00
2005 2385.00 2007 800.00
47495 Netter's Essential Histology, 47575 Elsevier's Integrated Anatomy and Embryology 48526 Theory and Practice of Histological Techniques, 6th edition 49007 Human Preimplantation Embryo Selection 49752 The Developing Human , 8th edition 49767 (PEULRORJLMDюRYHNDHG 55129 Histology: An Identification Manual, 62321 Histoloski atlas, 4 izdanje 66262 Developing Human SC 8th 67137 +LVWRORгNLDWODVWUHьH>[email protected]]GDQMH 68855 Male Fertility and Infertility 68863 COLOR ATLAS OF HISTOLOGY 5E 69017 Langman's Medical Embryology, 11E - IE 69263 Atlas histopatologija 69437 Modern Immunohistochemistry 71066 Netter's Histology Flash Cards, 71860 Histology An Illustrated Colour Text
William Ovalle Bruce Bogart John Bancroft
2007 5977.00 2007 3049.00 2007 14640.00
Cohen Keith Moore ,YDQ1LNROLьLVDUDGQLFL Robert Tallitsch 9HVQD/DюNRYLь9ODGLPLU %XPEDгLUHYLь Moore Berman, Irvin - autor Glover/Barratt GARTNER SADLER %DVWD-RYDQRYLь*RUGDQD autor Chu William K. Ovalle Barry Mitchell
2007 2007 2007 2008 2008
17690.00 5855.00 1790.00 4269.00 1990.00
2007 2006 2009 2009 2009 2009
3825.00 2160.00 3415.00 4270.00 3050.00 4320.00
2009 11590.00 2007 2927.00 2009 3049.00
76760 Junqueira's Basic Histology: Text and Atlas 12ed ISE MESCHER
2010 2782.00
77853 Embryology,
77909 Wheater's Review of Histology & Basic Pathology,
83061 Diagnostic Cytopathology, 3 Ed Expert Consult: Online and Print
109411 EMBRYOLOGY 5E
PB
109540 (PEULRORJLMDюRYHNDHG
109702 Histology: A Text and Atlas: With Correlated Cell and Molecular Biology, 6/e, International Edition
109884 Langmanova medicinska embriologija,10. izdanje
111720 Concise Histology,
112391 Deja Review Histology & Cell Biology, Second Edition
112392 Histology and Cell Biology: Examination and Board Review, Fifth Edition (Lange Basic Science)
113215 Osnove nanomedicine : embriologija, farmakologija, nanotehnologija
113447 Atlas of Endometrial Histopathology
Barry Mitchell Kate M. Baldwin Winifred Gray BRS (DUDEK) ,YDQ1LNROLьLVDUDGQLFL ROSS # W.THOMAS SADLER Leslie P. Gartner Jae W. Song Douglas F. Paulsen 0LOHQD3DSLь2EUDGRYLь 6X]DQD0LOMNRYLь/LGLMD0 Gisela Dallenbach-Hellweg, Dietmar Schmidt, Friede
2009 3049.00 2009 3049.00 2010 26840.00
2010 2010 2010
3044.00 1890.00 4757.00
2009 5460.00
2010 2010 2010
3659.00 1585.00 3781.00
2009 2160.00
2010 14736.00
38 od 116
Dietmar Schmidt, Friede
114148 Histology and Cell Biology: Examination and Board Review
PAULSEN
114322 LWW ILLUS Q&A REV ANATOMY EMBRYOLOGY PB
LAMBERT
115237 Osnovi oralne histologije i embriologije
James K. Avery, Daniel J Chiego
115238 Osnovna i oralna histologija i embriologija
9HVQD/DюNRYLь,YDQ 1LNROLь9HUD7RGRURYLь
116133 ATLAS HISTOLOGY FUNC CLINICAL CORR PB CUI
117235 CELL BIOLOGY & HISTOLOGY 6E
PB
BRS (GARTNER)
imunologija
6627 Color Atlas of Immunology
Burmester
7213 Immunology at a Glance-IE
Playfair
10357 *sp* Liver Immunology
Gershwin; Vierling
18941 Imunolosko prepoznavanje
0DWNR0DUXгLь
23608 *sp* Immunobiology Ed6
Janeway/Travers/Walport
25153 IMUNOLOGIJA, 6. dopunjeno i obnovljeno izdanje
,JRU$QGUHLV'UDJR%DWLQLь )LOLSэXOR'DQND*Uю
30064 Basic Immunology 2 ed - IE
Abbas
31583 Immunology with STUDENT CONSULT Access, 7th Roitt edition-IE
34609 Immune System E2
Parham
35310 Diagnostic Immunohistochemistry, 2nd edition
David Dabbs
36522 Oxford Handbook of Clinical Immunology and Allergy Spickett, Gavin (2/e)
36651 APPLETON & LANGE OUTLINE REVIEW OF MICROBIOLOGY & IMMUNOLOGY, 4 ED - IE
YOTIS
43654 Cellular and Molecular Immunology, 6th Edition With STUDENT CONSULT Online Access -IE
Abbas
2010 3026.00 2010 3410.00 0.00 0.00 2010 5978.00 2010 3044.00
2003 2001 2003 0 2004
1939.00 590.00 5074.00 812.00 990.00 4900.00
2006 2868.00 2006 3005.00
2004 4270.00 2006 26718.00 2006 2875.00
2005 1707.00
2007 3415.00
43781 LIPPINCOTT'S ILLUSTARTED REVIEW: IMMUNOLOGY
DOAN
2007 2440.00
43986 IMMUNOLOGY FOR MEDICAL STUDENTS 2E
Nairn
2007 3825.00
47459 USMLE ROAD MAP: IMMUNOLOGY ISE
PARMLEY
2006 1299.00
50389 Rapid Review Microbiology and Immunology, 55115 Basic Immunology,3 Ed 55740 Neuroendokrinoimunologija 56891 Insect Immunology, 59963 Immunology & Serology in Laboratory Medicine, 60774 Medical Immunology 62069 Osnovna imunologija Trece izdanje 66066 Psihoneuroimunologija 69437 Modern Immunohistochemistry 71064 Medical Microbiology and Immunology Flash Cards, Updated Edition, 71796 Basic and Clinical Immunology, 2nd Edition with STUDENT CONSULT access
Ken Rosenthal Abul Abbas Nancy Beckage Mary Louise Turgeon Abul K. Abbas, Andrew H. Lichtman 0LOLYRM%RUDQLь Chu Ken S. Rosenthal Mark Peakman
2007 2008 2000 2008 2008 2007 2008
3171.00 5123.00 649.00 6953.00 5611.00 9150.00 1890.00
2008 3113.00 2009 11590.00 2008 2927.00
2009 4757.00
74185 Illustrated Dictionary of Immunology 3ed
Cruse
2009 7441.00 39 od 116
74190 The Immune System, 3 Ed
Parham
75971 Cellular and Molecular Immunology,Updated Edition, Abul K. Abbas International Edition, 6th
76886 How the Immune System Works 3e
Sompayrac L
80568 Basic Immunology Updated Edition, 3rd Edition Functions and Disorders of the Immune System With STUDENT CONSULT Online Access
Abul K. Abbas
81183 IMUNOLOGIJA, 7. obnovljeno i dopunjeno izdanje
Milan Taradi
109774 REVIEW OF MEDICAL MICROBIOLOGY AND IMMUNOLOGY IE- 11 Ed
LEVINSON
111731 Rapid Review Microbiology and Immunology,3ed
Ken S. Rosenthal
114841 Immunology
Hall, Angela; Yates, Christine
115484 ZBIRKA TEST PITANJA IZ FIZIOLOGIJE I IMUNOLOGIJE
0DWNR0DUXгLь'DQND *UюHYLь
116063 Atlas of Immunology, Third Edition
Cruse
117713 Alergijske i imunoloske bolesti
-/LSR]HQюLьLVXUDGQLFL
119298 Deja Review Microbiology & Immunology, Second Edition
Eric Chen, Sanjay Kasturi
119870 Imunobiologija genitalnog trakta zena : karakteristike Kataranovski, Milena - autor LPXQVNRJVLVWHPDL]QDюDMXRGEUDQLRGLQIHNFLMD
infektivne bolesti
239 *sp* The Medical Management of AIDS 6 Ed Sande Sande
4118 *sp* The Johns Hopkins Hospital 2002 Guide to Medical Care of Patients with HIV Infection
John G. Bartlett
18865 Sterilizacija i dezinfekcija u medicini
9ODWND%RMLь7XUюLь
24338 Tuberculosis and Nontuberculosis Mycobacterial Infections
Schlossberg
26092 Manual Of Clinical Problems In Infectious Disease, 5 Nelson M. GantziNelson
Ed-IE
Murray Gantz
26615 1(852,1)(.&,-(3ULUXюQLN
Ivan Soldo, Jasmina Timarac
2009 2009 2008 2010 2009 2010 2010 2010 2005 2010 2010 2010 2011 1999 2001 1994 2005 2005 2005
5002.00 3688.00 2439.00 5123.00 5320.00 2751.00 3171.00 3250.00 1750.00 9393.00 5180.00 1951.00 1620.00 900.00 400.00 700.00 7320.00 4209.00 1400.00
30616 Oxford Handbook of Genitourinary Medicine, HIV and AIDS 30826 Hepatitis B 32282 The Nobel Prize Winning Discoveries in Infectious Diseases 36277 Colour Atlas of Infectious Diseases, 4th edition 55708 Virusne osipne bolesti 55711 ZOONOZE 55730 Virusni hepatitisi 59847 Oxford Handbook of Tropical Medicine (3/e) 59850 Oxford Handbook of Expedition and Wilderness Medicine 59949 Feigin and Cherry's Textbook of Pediatric Infectious Diseases: Expert Consult: Online and Print, 2-Volume Set (Textbook of Pediatric Infectious Disease (Feigin)) 62026 Topley and Wilson's Microbiology and Microbial Infections 10e: Immunology 62027 Topley and Wilson's Microbiology and Microbial
Pattman, Richard Tobias Heintges David Rifkind, Geraldine Freeman Ronald T. Emond (OHRQRUD*YR]GHQRYLьL saradnici $QWRQLMHYLь%RеLGDU 'UDJDQ'HOLь3UHGUDJ 1LNROLь0LOHQD%RеLь Eddleston, Michael; Davidson, Robert; Brent, Andre Johnson, Chris; Anderson, Sarah; Dallimore, Jon; W Ralph D. Feigin, James Cherry, Gail J. DemmlerHar Stefan H E Kaufmann Brian W J Mahy
2005 2750.00
2006 2695.00 2005 3171.00
2003 5001.00 2001 1272.00
2001 1998
649.00 779.00
2008 2500.00
2008 3000.00 2008 32696.00
2007 25498.00 2006 127978.00 40 od 116
Infections 10ed Cd Rom
62063 Topley and Wilson's Microbiology and Microbial Infections 10e: Virology 2-Volume Set (incl free Cd)
Brian W J Mahy
63673 Manson's Tropical Diseases, International Edition, 22nd Edition
67661 Oxford Handbook of Infectious Diseases and Microbiology
Torok, Estee; Moran, Ed; Cooke, Fiona
70089 $OJRULWPLVDYUHPHQHGLMDJQRVWLNHLOHюHQMDLQIHNWLYQLK %UNLь6QHеDQDDXWRU EROHVWLXWUXGQRьL
71712 Infection Control and Management of Hazardous Materials for the Dental Team, 4th Edition
Chris H. Miller
2007 38430.00 2008 4918.00 2009 3250.00 2009 972.00 2009 4269.00
72989 Mandell, Douglas, and Bennett's Principles and Practice of Infectious Diseases,7 Ed
Gerald L. Mandell
76959 .OLQLюNDLQIHNWRORJLMDRGDEUDQDSRJODYOMD]DVWXGHQWH /MLOMDQD.RQVWDQWLQRYLь medicine i stomatologije
77129 KOZNE I SPOLNO PRENOSIVE BOLESTI
(VPD+DOHSRYLьHюHYLь
80990 An Introduction to Infectious Disease Modelling
Vynnycky, Emilia; White, Richard
81025 Infectious Diseases: Expert Consult: Online and Print - Jonathan Cohen 2 Volume Set
81200 Diagnostic Pathology of Infectious Disease,
Richard L. Kradin
82011 Case Studies in Pediatric Infectious Diseases
Berkowitz
82081 Pediatric Practice: Infectious Disease
Shah
110202 Oxford Handbook of Genitourinary Medicine, HIV, and Sankar, Nathan; Pattman,
Sexual Health
Richard; Handy, Pauline;
110362 Harrison's Infectious Diseases
Dennis L. Kasper, Anthony S. Fauci
110417 ,QYD]LYQHJOMLYLюQHEROHVWLXKXPDQRMSRSXODFLML
110529 +HPRUDJLюQDJUR]QLFDVDEXEUHеQLPVLQGURPRP
=RUDQ.RYDюHYLь'UDJDQ -RYDQRYLь
111870 Insect Infection and Immunity
Rolff, Jens; Reynolds, Stuart
113373 Microbial Zoonoses and Sapronoses
Zdenek Hubбlek, Ivo Rudolf
117222 TRANSPLANT INFECTIONS 3E
CB
BOWDEN
118525 Tuberculosis
Schaaf
interna medicina
798 *sp* TNM Supplement: A Commentary on Uniform Use, Wittekind, Henson 2 Ed
14493 Hypertension Management for the Primary Care Clinician
18823 Beskrvna medicina
J.Slipac
18880 ,QWHUQLVWLюNDRQNRORJLMD
=ULQND0UгLь.UPSRWLь
19828 *sp* Practical Guide to Abdominal and Pelvic MRI
Leyendecker, John R.
20718 *sp* Interactions of Blood and the Pulmonary Circulation (American Heart Association Monograph Series.)
E. Kenneth Weir,Helen L. Reeve,John T. Reeves
22073 *sp* Diagnosis of Endometrial Biopsies and Curettings: Kurman, Robert J. A Practical Approach, 2 Ed
24338 Tuberculosis and Nontuberculosis Mycobacterial Infections
Schlossberg
24374 Step by Step Wound Healing
Sylvie MeaumeiLuc Teot
24932 Oxford Handbook of Clinical and Laboratory Investigation (Oxford Handbooks S.)
Drew Provan
2009 32696.00
2001 648.00
2009 1575.00 2010 3745.00
2010 22570.00
2010 2007 2009 2010
15250.00 4514.00 6221.00 3495.00
2010 7563.00
2009 2008
648.00 540.00
2009 4996.00
2010 17004.00 2010 16470.00 2009 4391.00
2001 1784.00
2003 7688.00
2003 2004 2004 2002
2100.00 4900.00 4000.00 900.00
2005 4816.00 2005 7320.00 2005 2195.00 2005 2875.00 41 od 116
27218 Interna medicina l i ll (grupa autora, 5.izdanje 27422 Osteoporosis in Focus 27886 Medical Imaging 31731 +DUULVRQRYPHGLFLQVNLSULUXюQLNL]GDQMH 34577 Differential Diagnosis in Ultrasound 34610 *sp* Oxford Handbook of Clinical Medicine, 7 Ed 34668 Current Diagnosis and Treatment: Pain - ISE
urednik Dragoljub 0DQRMORYLь Neil Ferguson Renton Kasper, Braunwald, Fauci, Hauser, Longo, Jameson Gunter Schmidt Longmore, Murray Von Roenn
35261 BOARDS & WARDS REVIEW USMLE STEP 35390 Siegenthaler`s Differential Diagnosis in Internal Medicine - from Symptom to Diagnosis 36290 Cost Effective Diagnostic Imaging, 4th edition 39625 *sp* Primary Care Medicine: Office Evaluation and Management of the Adult Patient,5 Ed 39628 DISEASES 4E 39721 LIPPIN NURSING DRUG GUIDE 2007 40872 Cecil Essentials of Medicine 7/e sc ISE 42394 The Osler Medical Handbook, 2nd edition 43524 *sp* WASH MAN MEDICAL THERAPEUTICS 32E PB 43784 ESSENTIALS OF FAMILY MEDICINE 5E 43988 Pocket Essentials of Clinical Medicine, International Edition, 4th Edition 43989 Hutchison's Clinical Methods, 22 Ed - IE 43997 Clinical Chemistry Made Easy IE 43999 MEDICAL SCIENCES -with STUDENTCONSULT access-IE
AYALA Siegenthaler Zachary Grossman GOROLL SPRINGHOUSE KARCH Andreoli Johns Hopkins Hospital WASH UNIVERSITY SLOANE Ballinger & Patchett Swash Hughes Naish
47388 FAMILY MEDICINE CERTIFICATION RE
LIPSKY
47389 Saint Frances Guide Clinical Clerkship in Outpatient BENT Med
47419 Medicine Recall
James D. Bergin
47420 Taylor's Manual of Family Medicine (Spiral Manual) PAULMAN
47463 Last Minute Internal Medicine ISE
Miksad, Rebeka
47669 Cecil Textbook of Medicine: Expert Consult - Online and Print, 23 Ed-IE
Goldman
47836 Oxford Handbook of Clinical Medicine and Oxford Handbook of Medical Sciences Pack
Longmore, Murray; Wilkinson, Ian; Turmezei, Tom; C
48336 Underground Clinical Vignettes Step 2: Internal
Sandra I. Kim, Todd A.
Medicine I - Cardiology, Endocrinology,
Swanson
Gastroenterology, Hematology/oncology (Underground
Clinical Vignettes)
48337 Underground Clinical Vignettes Step 2: Internal Medicine II - Dermatology, Infectious Disease, Nephrology, Urology, Pulmonary, Rheumatology, Allergy (Underground Clinical Vignettes)
Sandra I. Kim, Todd A. Swanson
49006 Mayo Clinic Internal Medicine Concise Textbook
Habermann Thomas M
50386 Ultrasound. A Practical Arrroach to Clinical Problems Edward I. Bluth, Peter H. Arger, Carol B. Benson
52986 *sp* Harrison's Principles of Internal Medicine, 17th Edition (Single Vol.)
Anthony S. Fauci, Eugene Braunwald, Dennis L. Kasp
2009 5346.00
2004 2004 2005
3837.00 3049.00 2700.00
2005 18355.00 2007 1500.00 2006 3715.00
2006 2434.00 2006 11875.00
2006 4757.00 2005 2500.00
2005 2006 2007 2006 2007
3288.00 2190.00 3688.00 4513.00 1200.00
2007 3288.00 2007 1775.00
2007 2007 2009
2322.00 955.00 2731.00
2007 3904.00 2007 2434.00
2007 2007 2008 2007
1952.00 2745.00 2428.00 8744.00
2007 4996.00
2007 2135.00
2007 2135.00
2007 6710.00 2007 18355.00 2008 7550.00 42 od 116
53894 *sp* Harrison's Principles of Internal Medicine 17 Rev ed c((2v.)) 55098 Physical Exam Health Assesment 5ed IE
Jarvis
2008 8950.00 2008 3278.00
55714 Propedevtika interne medicine

56137 Underground Clinical Vignettes Step 2 Bundle, 4e
KIM
57312 Netter's Internal Medicine, 2nd Edition
Marschall Runge
58081 Salivary Diagnostics
Wong D
59885 Evidence-Based Medical Consultation
Daniel Steinberg, Jennifer S. Myers, Chitra Komal
59977 Early Diagnosis and Treatment of Cancer Series: Head Wayne Koch and Neck Cancers (Early Diagnosis in Cancer)
59998 Clinical Examination: With STUDENT CONSULT Access
Owen Epstein, G. David Perkin, John Cookson
60735 Mayo Clinic Internal Medicine Review: Eighth Edition (MAYO INTERNAL MEDICINE BOARD REVIEW)
61533 Textbook of Clinical Hemodynamics
Michael Ragosta
61809 INTERNA MEDICINA, 4 Ed
Bozidar Vrhovac, Branimir -DNгLьдHOMNR5HLQHU%
62037 Making Sense of Clinical Examination of the Adult Patient: a Hands on Guide
Douglas Model
62041 A Textbook of General Practice Second Edition
Dr Anne Stephenson
62083 ,QWHUQDSURSHGHYWLND)L]LюNDGLMDJQRVWLND
$QWLь5DWRPLUDXWRU
63505 Klinische Pneumologie
Matthys, H.; Seeger, W. (Hrsg.)
64905 INTERNA MEDICINA
'XEUDYNR3HWUDюLVXUDGQLFL
65236 Repetitorijum iz interne medicine : podsetnik za ispit Stajic
65241 Interna medicina : za studente stomatologije
%UDQND'DSюHYLьLVDUDGQLFL
66272 Kumar and Clark's Clinical Medicine, 7 Ed-IE
Kumar
66285 Davidson's Essentials of Medicine
Innes
66411 DEJA REVIEW: INTERNAL MEDICINE -ISE
SAADAT
66412 HARRISON'S PRINCIPLES OF INTERNAL MEDICINE, SELF-ASSESSMENT AND BOARD REVIEW -ISE
WIENER
66473 A Pocket Manual of Differential Diagnosis 5E PB
ADLER
66477 Washington Manual General Internal Medicine Subspecialty Consult, 2 Ed-ISE
WASHINGTON UNIV
66481 Oxford Handbook of Clinical Medicine and Emergencies in Clinical Medicine Pack
Longmore, Murray; Wilkinson, Ian; Turmezei, Tom; C
66484 Oxford Handbook of Clinical Specialties (8/e)
Collier, Judith; Longmore, Murray; Turmezei, Tom;
66485 Oxford Handbook of Clinical Diagnosis (2/e)
Llewelyn, Huw; Ang, Hock Aun; Lewis, Keir E; Al-Ab
66488 Davidson's Clinical Cases-IE
Mark Strachan
66499 Crash Course: History and Examination,
John Brain
66978 Bates' Guide to Physical Examination and History Taking
BICKLEY #
67228 Textbook of Physical Diagnosis with DVD: History and Mark Swartz Examination With STUDENT CONSULT Online Access, 6 Ed
69019 Ferri's Best Test,
Fred F. Ferri
69027 Oxford Handbook of Critical Care (3/e)- IE
Singer, Mervyn; Webb, Andrew
2009 2008 2008 2008 2007
950.00 10126.00 7929.00 9150.00 4269.00
2008 10979.00
2008 5733.00
2008 6100.00
2008 7807.00 2008 14700.00
2006 2195.00
2004 2561.00 2008 1080.00 2008 13675.00
2008 2005 2006 2009 2009 2008 2008
4200.00 675.00 1080.00 3688.00 1775.00 1556.00 1964.00
2008 3477.00 2008 2867.00 2008 4996.00
2009 2500.00
2009 2750.00
2008 2008 2008
1502.00 2927.00 4331.00
2009 7563.00
2009 3171.00 2009 2750.00 43 od 116
71281 Macleod s Clinical Examination 12th SC IE
Douglas
71570 Churchill's Pocketbook of Clinical Practical Procedures Patel & Knight for Junior Doctors
71668 Ferri's Clinical Advisor 2010 5 Books in 1, Expert Consult - Online and Print
Fred Ferri
2009 2185.00 2009 2805.00 2009 8295.00
71820 Palliative Medicine-Expert Consult: Online and Print T. Declan Walsh
2008 15372.00
71865 Davidson's Foundations of Clinical Practice,
Hazel R. Scott
71867 Medical communication skills and Law Made Easy, Tsong Kwong
71900 Introduction to Renal Therapeutics - First Edition
C. Ashley and C. Morlidge
72304 Oxford Handbook of Key Clinical Evidence, 1 Ed
Harrison, James; Kulkarni, Kunal; Baguneid, Mohame
72311 Oxford Handbook of Gastrointestinal Nursing
Norton
72434 Interna medicina
6WHYDQ,OLь
72620 Oxford Handbook of Neuroscience Nursing, 1 Ed
Woodward, Sue; Waterhouse, Catheryne
73011 New Liver Anatomy: Portal Segmentation and the Drainage Vein
Munemasa Ryu, Akihiro Cho, Hiroshi Yamamoto
73112 ECG Interpretation: An Incredibly Visual! Pocket Guide SPRINGHOUSE
73119 CLINICAL PRACTICE EMERGENCY MED 5E CB WOLFSON
73240 BATES POCKET GUIDE PHYS 6E ( INT ED ) PB
BICKLEY
73321 Case Files: Internal Medicine, 3 Ed - ISE
TOY
2009 2009 2008 2009
3415.00 2073.00 3837.00 3250.00
2008 2009 2009
2375.00 3240.00 2870.00
2009 17571.00
2009 2009 2009 2009
2434.00 18544.00 2135.00 1732.00
73334 HANDBOOK OF SIGNS & SYMPTOMS 4E PB SPRINGHOUSE
74183 Oxford Handbook of Clinical Medicine PDA and Book Longmore, Murray;
Pack (7/e)
Wilkinson, Ian; Turmezei,
Tom; C
74366 Oxford Handbook of Musculoskeletal Nursing
Oliver, Susan
74691 CLINICAL CASES IN FLUID AND ELECTROLYTE BALANCE
Geoffrey Couser, Justin Walls
76889 Cosmetic Dermatology: Products and Procedures, 1 Ed Draelos Z
77017 Mosby's Diagnostic and Laboratory Test Reference,9 Kathleen Deska Pagana Ed
77577 Mosby's Manual of Diagnostic and Laboratory Tests,4 Kathleen Deska Pagana Ed
79276 Davidson's Principles and Practice of Medicine International Edition, 21st Edition-With STUDENT CONSULT Online Access
Colledge, Walker & Ralston
2009 3782.00 2007 4751.00 2009 2870.00 2009 2683.00 2010 18178.00 2008 3903.00 2009 4147.00 2010 3415.00
79375 Churchill's Pocketbook of Differential Diagnosis International Edition, 3rd Edition
By Raftery, Lim & Ostor
2009 1502.00
80758 Oxford Handbook of Clinical Medicine (8/e) 80840 8OWUD]YXюQDGLMDJQRVWLNDGLIHUHQFLMDOQDGLMDJQR]D atlas 81102 Oxford Handbook of Clinical Specialties - Mini edition (8/e) 81239 Mosby's Guide to Physical Examination, 81244 Andreoli and Carpenter's Cecil Essentials of Medicine, 8th Ed, With STUDENT CONSULT Online Access
Longmore, Murray; Wilkinson, Ian; Davidson, Edward Guenter Schmidt Collier, Judith; Longmore, Murray; Turmezei, Tom; Henry M. Seidel Thomas E. Andreoli
2010 2625.00 2010 7990.00 2010 3120.00 2010 6587.00 2010 6343.00
81354 Andreoli and Carpenter's Cecil Essentials of Medicine, Andreoli, Benjamin, Griggs
2010 4371.00 44 od 116
International Edition, 8th Edition
& Wing
81554 8YRGXNOLQLюNXSUDNVXXGеEHQLN]DRVQRYQXQDVWDYX 9HOMNRYLь0LRGUDJDXWRU [za predmet fizikalna medicina i rehabilitacija]
82782 CONCISE REVIEW CLIN LAB SCIENCE 2E PB
HUBBARD
109326 Clinical Exemination
Talley
109682 THE ICU BOOK 3E (INT ED)
CB
MARINO
110886 MANUAL LAB DIAGNOST TESTS 8E (INT ED) PB FISCHBACH
111707 Atlas of Essential Procedures,
Michael Tuggy
111767 Ferri's Differential Diagnosis,2ed
Fred F. Ferri
112350 CURRENT Diagnosis & Treatment in Family Medicine, Jeannette South-Paul,
Third Edition (Lange Current Series)
Samuel C. Matheny, Evelyn
L.
112551 Laboratory Medicine: The Diagnosis of Disease in the Michael Laposata Clinical Laboratory (Lange Basic Science)
113862 SAPIRAS ART & SCIENCE BEDSIDE DIAG 4E CB ORIENT
114161 CURRENT Medical Diagnosis and Treatment 2011 (Lange Current Series)
Stephen J. Mcphee, Maxine A. Papadakis, Michael W.
114242 5 MINUTE CLINCAL CONSULT 2011 PACKAGE
DOMINO
114495 Mosby's Physical Examination Handbook,
Henry M. Seidel
114593 Mosby's Diagnostic and Laboratory Test Reference, Kathleen Deska Pagana
114686 Professional Guide to Signs and Symptoms, 6e
SPRINGHOUSE
115211 WASH MAN MEDICAL THERAPEUTICS 33E PB WASH UNIVERSITY
115218 Comprehensive Pocket Atlas of Hysteroscopy
Fried
115236 +DULVRQRYSULUXюQLNPHGLFLQH
Fauci
115351 ALGORITMI U GASTROINTESTINALNOJ
R. PulaniК i suradnici
ENDOSKOPIJI I ENDOSKOPSKOM ULTRAZVUKU
115371 NEUROSONOLOGIJA
VIDA DEMARIN I DRUGI
2007 1165.00
2009 2010 2010 2010 2010 2010 2011
4270.00 4371.00 6094.00 2928.00 7807.00 2073.00 3659.00
2010 5245.00
2010 8906.00 2010 6953.00
2010 2010 2010 2010 2010 2010 2010
7564.00 3659.00 3903.00 4331.00 3654.00 6465.00 0.00 2100.00
5496.00
115483 Mйdecine interne
Johannes-Martin Hahn, Collectif
116058 Examination Medicine,
Nicholas J. Talley
118440 Evidence-Based Medicine,
Sharon E. Straus
118676 General Practice Companion Handbook, 5 Ed
John Murtagh
ishrana
270 *sp* Mini Nutritional Assessment (MNA):Research and Ed Vellas, Garry Practice in the Elderly, vol1
625 Pocket Guide to Micronutrients in Health and Disease Zimmermann
807 Burgerstein`s Handbook of Nutrition
Zimmermann
4206 Molecular Basis of Human Nutri
Sanders
5001 *sp* Dimesions of Food, 5 Ed
Vaclavik Vick
10720 Vitamins and Minerals
Jane Higdon
18845 Kava,droga ili lijek
5RNRдLYNRYLь
18850 Dijetetika
5RNRдLYNRYLь
19588 VITAMINI I MINERALI
0DULFD0HGLьвDULь
21742 Environmentally Friendly Technologies for Agricultural Shimshon Ben-Yehoshua Produce Quality
25371 ADVANCED SPORTS NUTRITION
BENARDOT, D
25490 Pocket Atlas of Nutrition
Hans K. BiesalskiiPeter Grimm
29675 *sp* Food Irradiation Research and Technology
Sommers
30516 Disordered Eating Among Athletes
Beals, Katherine A.
2009 7425.00
2010 2010 2011
5611.00 3659.00 6587.00
1999 6320.00
2001 2001 2003 2002 2003 1998 2002 2001 2005
3775.00 7015.00 3293.00 2013.00 5935.00 1400.00 2800.00 3500.00 11834.00
2006 1829.00 2005 3775.00
2006 5795.00 2004 3721.00 45 od 116
36181 Handbook of Clinical Nutrition, 4th edition
Douglas Heimburger
36188 Williams' Essentials of Nutrition & Diet Therapy, 9th edition
Eleanor Schlenker
36520 Oxford Handbook of Nutrition and Dietetics
Webster-Gandy, Joan
43514 An Evidence-Based Approach to Dietary Phytochemicals
Jane Higdon
47956 A Dictionary of Food and Nutrition (2/e)
Bender, David A.
48436 Nutraceuticals, 2 Ed
Brian Lockwood
49884 эXGRWYRUQDKUDQD]DGMHFXVWU
50825 Food Allergy
Maleki
51228 Krause's Food Nutrition & Diet Therapy 12th IE
Mahan, L. Kathleen, EscottStump, Sylvia
54487 Food and Beverage Management,
Bernard Davis
54970 Essentials in Food Science (Food Science Text)
Vickie A. Vaclavik, Elizabeth W. Christian, Dennis
59952 Williams' Basic Nutrition & Diet Therapy, 13 ed
Staci Nix
59953 Mosby's Pocket Guide to Nutritional Assessment and Mary Courtney Moore Care
60539 Eat Well & Keep Moving 2nd Edition
Lilian Cheung et al
60578 Contemporary Nutrition
Gordon M. Wardlaw, Anne M Smith
68988 Introduction to Human Nutrition 2e
Gibney M
69084 Mycotoxins in Fruits and Vegetables,
R. Barkai-Golan
69087 Practical Design, Construction and Operation of Food J. Peter Clark Facilities,
70625 ONO SI STO JEDES
GILLIAN MCKEITH
72460 Chinese Nutrition Therapy: Dietetics in Traditional Chinese Medicine (TCM)
Joerg Kastner
72461 Health through Inner Body Cleansing: The Famous F. Erich Rauch X. Mayr Intestinal Therapy from Europe
73005 Nutrition and Metabolism: Underlying Mechanisms and Clinical Consequences (Nutrition and Health)
73122 HANDBOOK OF NUTRITION AND KIDNEY 6E PB MITCH
73134 Fluids and Electrolytes: An Incredibly Easy! Pocket Guide, 2 Ed
LWW
74452 The Cancer Prevention Diet 3rd Ed
Kushi, M/Jack,a
74508 Nutrition for Health, Fitness & Sport
Melvin H Williams
76958 Dijetetika = (Nutrition and Dietetics)
0DMD1LNROLь
80837 Napredna sportska ishrana
Dan Benardot
81494 Kako lakse i duze ziveti sa obolelim srcem : mali SULUXюQLN]DEROHVQLNHLVYHRQHNRMLWRQHеHOHGD postanu
9XюLQLь0LKDLORDXWRU
82392 Nutrition: Science and Applications with Booklet Package, 2 Ed
Lori A. Smolin, Mary B. Grosvenor
110363 Clinical Sports Nutrition
Louise Burke
110870 %LRWHKQRORгNLUHюQLN]DKUDQXLSROMRSULYUHGX
A. Zaid, H.G.Hughes, E.Porceddu, F.Nicholas, M. Pl
113528 Nutritional Strategies for the Very Low Birthweight Infant
Adamkin
113953 EXERCISE NUTRITION SPECIAL POPULATION PB WILLIAMSON
114488 Advancing Dietetics and Clinical Nutrition,
Anne Payne
2006 4025.00 2006 6221.00
2006 2500.00 2006 5395.00
2005 2007 2006 2008
1499.00 5118.00 1628.00 9455.00 5054.00
2008 2434.00 2008 6005.00
2008 4879.00 2008 3049.00
2007 3909.00 2008 5245.00
2009 4575.00 2008 8539.00 2008 12200.00
2006 1607.00 2009 5395.00
2008 1939.00
2009 9860.00
2009 4026.00 2009 2434.00
2009 2009 2008 2010 2010
1829.00 5611.00 648.00 1595.00 160.00
2010 6465.00 2010 5489.00 2007 648.00
2009 3293.00 2010 4209.00 2010 4879.00
46 od 116
114576 Williams' Essentials of Nutrition and Diet Therapy,
Eleanor Schlenker
114900 Human Nutrition Text and Evolve ebooks Package, Catherine Geissler
115474 Manuel de diйtйtique : En pratique mйdicale courante Albert-Franзois Creff, Daniel Layani
116009 Nutrition and the Cancer Patient
Del Fabbro, Egidio; Bruera, Eduardo; Demark-Wahnef
kardiologija i kardiovaskularna medicina
9943 *sp* Clinical Recognition of congenital heart disease, Perloff 5th Edition
14493 Hypertension Management for the Primary Care Clinician
17836 *sp* Atlas of Three-Dimensional Echocardiography Nanda
18132 Principles Of Exercise Testing and Interpretation
WASSERMAN
Includig Pathophysiology and Clinical Applications, 4/e
18870 Fibrilacija atrije 18877 Pedijatrijska kardiologija,2.dio 18878 Pedijatrijska kardiologija 18879 .OLQLюNDNDUGLRORJLMD 19590 FETALNA EHOKARDIOGRAFIJA Prenatalna GLMDJQRVWLNDSULURGQLKVUюDQLKJUHгDND 20574 Introduction to Vascular Ultrasonography,5 Ed 20715 *sp* Cardiogenic Shock 23632 *sp* Vascular Surgery,6 Ed 24837 Innovative Management of Atrial Fibrillation 25307 *sp* Cardiology 26032 Churchill's Pocketbook of Cardiology 2ed- IE
'XEURYNR3HWUDю ,YDQ0DOюLь ,YDQ0DOюLь )HGRUэXVWRYLь Mladen Miljan William J. Zwiebel Hollenberg, Steven M. Robert Rutherford David Schwartzman John P. DiMarco,Walter J. Paulus,Michael H. Crawfo Grubb
26086 High-yield Systems: Heart,IE
Ronald W. Dudek
26623 NUKLEARNA KARDIOLOGIJA I PULMOLOGIJA
67HеDN',YDQюHYLь' 'RGLJ,эLNHг
29595 *sp* Braunwald's Heart Disease Review and Assessment, 7th edition
Leonard Lilly
30833 Pocket Atlas of Echocardiography
Boehmeke, Doliva
31326 Pediatric Cardiology
Vetter
34745 ECG Complete - IE
Bowbrick
35705 Mastering Endovascular Techniques: A Guide to Excellence
LANZER
36170 Clinical Electrocardiography, 7th edition
Ary Goldberger
36203 Cardiovascular Physiology, 9th edition
Matthew Levy
38952 *sp* Hypocretins: Integrators of Physiological Signals
40859 Mayo Clinic Cardiology Concise Textbook Third Edition Murphy Joseph G
43523 PRACTICAL GUIDE CARDIAC PACING 6E PB
MOSES
43798 THE HUMAN HEART 2E
PHIBBS
47407 CARDIOPULMONARY BYPASS 3E
Glenn P. Gravlee, Richard F. Davis, Alfred H. Stam
48338 Moss and Adams' Heart Disease in Infants, Children ALLEN and Adolescents: Including the Fetus and Young Adult, 2 Volume Set
48402 Practice of Clinical Echocardiography, 3rd edition
Catherine Otto
48892 Atlas of Cardiac Nuclear Medicine
Jain
48916 Cardiovascular Multidetector Ct Angiography
Raman
2010 2010 2004
6221.00 5977.00 5940.00
2010 9379.00
2003 11017.00 2003 7688.00 2002 5795.00 2004 8540.00
1996 2003 2001 1995 1991
1400.00 3500.00 2100.00 7000.00 546.00
2004 2002 2005 2005 2003
9759.00 5636.00 20411.00 4819.00 2450.00
2006 1775.00
2005 1580.00 2005 2800.00
2006 1250.00
2005 2006 2006 2006
4315.00 6221.00 1092.00 9760.00
2006 2006 2005 2006 2007 2007 2007
5611.00 3415.00 6234.00 10370.00 6100.00 3654.00 12566.00
2007 21716.00
2007 19642.00 2007 14640.00 2007 12078.00 47 od 116
48916 Cardiovascular Multidetector Ct Angiography 48937 *sp* Cardiovascular Molecular Imaging 48961 3d Echocardiography 50089 Akutni infarkt miokarda 50160 Braunwald's Heart Disease e-dition, 8th edition 50227 CLINICAL CARDIAC ELECTROPHYSIOLOGY 4E CB 51373 Cardiac Surgery in the Adult 51725 Ultrasonography in Vascular Diseases: A Practical Approach to Clinical Problems 51801 Textbook of Interventional Cardiology with Dvd, 5 Ed 53765 3UDNWLюQDHOHNWURNDUGLRJUDILMD 53854 Pedijatrsijka kardiologija 3 deo 55094 150 ECG problems 2ed IE 55095 The ECG Made Easy 7e IE
Raman Gropler Robert J Shiota 3URIGU9HOLERU2EUDGRYLь Peter Libby JOSEPHSON Lawrence H. Cohn Edward I. Bluth, Philip W. Ralls, etc. Eric Topol Mijo Bergovec ,YDQ0DOюLьLVXUDGQLFL Hampton Hampton
2007 2007 2007 2007 2007 2008 2007 2007
12078.00 18666.00 10370.00 5500.00 26718.00 14518.00 25497.00 5395.00
2007 1997 2008 2008 2008
21228.00 3411.00 2100.00 1365.00 1228.00
55096 The ECG in Practice 5th IE
Hampton
55134 Braunwald's Heart Disease Review and Assessment, Leonard Lilly
56119 Diagnostic Imaging: Cardiovascular,
Suhny Abbara
58250 Echocardiography
Leeson, Paul; Mitchell, Andrew RJ; Becher, Harald
58547 Easy ECG. Interpretation Differential Diagnoses
Hans-Holger Ebert
59909 Essential Echocardiography
Alisdair Ryding
59927 Drugs for the Heart, 7th Edition
Lionel Opie
60137 Cardiovascular MRI: 150 Multiple-Choice Questions Peter G. Danias and Answers (Contemporary Cardiology)
60138 Cardiovascular MRI in Practice: A Teaching File Approach
John D. Grizzard, Robert M. Judd, Raymond J. Kim
60402 Meyler's Side Effects of Cardiovascular Drugs (Meylers Jeffrey K. Aronson Side Effects) (Meylers Side Effects)
60612 CARDIOVASCULAR MRI TEACHING MANUAL
BIEDERMAN
60734 American Medical Association Guide to Preventing and AMA Treating Heart Disease: essential information You and Your Family Need to Know About Having a Healthy Heart
60765 Mayo Clinic Cardiology Concise Textbook and Mayo Joseph G. Murphy, Clinic Cardiology Board Review Questions & Answers: Margaret A. Lloyd (Text and Q&A Set)
61533 Textbook of Clinical Hemodynamics
Michael Ragosta
61719 Kardiomiopatije i disfunkcija srca. Invazivna dijagnostika
6WDPHQNRYLьдLYRMLQM autor
61800 Echocardiographic Anatomy in the Fetus
Enrico M. Chiappa, Andrew C. Cook, Gianni Botta
62016 Leg Ulcers 3rd Edition
Negus et al
62046 Women's Vascular Health
Ian a Greer
62049 Hyperlipidaemia Third Edition
Durrington, P.N.
62072 7URPER]DGXERNLKYHQDSURILODNVDLOHюHQMH
0DNVLPRYLьдLYDQ9 autor
62145 -HGLQD(.*NQMLJDNRMDьHYDPLNDG]DWUHEDWL
Malcolm S. Thaler
62181 (.*SRGVMHWQLNYRGLю]DLQWHUSUHWDFLMX(.*L terapijske protokole
DZouns, Sirli A. - autor
63275 Biomarkers in Heart Disease
de Lemos J
63644 Atlas transezofagusne ehokardiografije
Josip Vincelj
63759 Cardiac Pacing and ICDs 5e
Ellenbogen K
2008 2008 2008 2007
1502.00 7197.00 22936.00 4370.00
2004 2007 2008 2008
3235.00 5367.00 5611.00 6231.00
2008 13035.00
2008 4879.00
2007 11834.00 2008 1707.00
2007 12200.00
2008 7807.00 2008 1944.00
2008 14736.00
2005 2006 2007 1996
12810.00 12078.00 9150.00 149.00
2009 890.00 2006 1188.00
2008 2003 2008
7685.00 5151.00 3903.00
48 od 116
64310 Cardiac Electrophysiology: From Cell to Bedside: Expert Consult: Online and Print, 5 Ed
Douglas P. Zipes
66278 Echo Made Easy 2ed IE
Kaddoura
66477 Washington Manual General Internal Medicine Subspecialty Consult, 2 Ed-ISE
WASHINGTON UNIV
66494 Practical Cardiology,
Tracey Baker
66725 The Washington Manual Cardiology Subspecialty Consult 2E -ISE
WASHINGTON UNIV
66729 HANDBK PATIENT CARE VASCULAR DIS 5E PB RASMUSSEN
66972 Clinical Arrhythmology and Electrophysiology: a Companion to Braunwald's Heart Disease,
Ziad Issa
67138 Kardiovaskularne bolesti,prirucnik
)HGRUэXVWRYLь0LMR %HUJRYHF/-LOMDQD%DQILь
68457 Emergencies in Cardiology 2/e
Myerson, Saul G.; Choudhury, Robin P.; Mitchell, A
68819 Nuclear Cardiology: Technical Applications
Gary V Heller, April Mann, Robert C. Hendel
68824 Preventive Cardiology
Jennings, Catriona; Mead, Alison; Jones, Jennifer;
68852 Fetal Echocardiography
Allan/Cook/Huggon
69630 Stres i srce
6YHWRPLU36WRеLQLь
69633 .OLQLюNDHOHNWURIL]LRORJLMDVUюDQLKDULWPLMDRGPROHNXOD /DPELь,YDQ6DXWRU do postelje
69674 Current Diagnosis & Treatment in Cardiology, 3/e ISE Crawford
70822 Hurst's the Heart Manual of Cardiology 12ed ISE
O'ROURKE
71138 Textbook of Clinical Echocardiography,4 Ed 71352 Congenital Heart Disease in Adults, 71585 Cardiology Secrets,3 Ed 71609 The Pediatric Cardiology Handbook, 4 Ed 71660 Valvular Heart Disease: A Companion to Braunwald's Heart Disease, 3rd Edition Expert Consult - Online and Print
Catherine M. Otto Joseph K. Perloff Glenn N. Levine Myung K. Park Catherine M. Otto
71784 Vascular Ultrasound, 72396 Clinical Cardiac CT: Anatomy and Function 72473 Cardiac Imaging: A Multimodality Approach 72474 Vascular Imaging (Direct Diagnosis in Radiology: DXDirect!) 72511 BASIC & BEDSIDE ELECTROCARDIOGRAPHY PB 72622 The ESC Textbook of Cardiovascular Medicine (2/e) 72988 Paediatric Cardiology, 3rd Ed Expert Consult - Online and Print
Abigail Thrush Ethan Halpern Manfred Thelen, Raimund Erbel, Karl-Friedrich Krei Karl J. Wolf BALTAZAR Camm, A. John; Luscher, Thomas F.; Serruys, Patric Robert H. Anderson
72990 Comprehensive Vascular and Endovascular Surgery Hallett, John W.
73096 ELECTROPHYSIOLOGY OF ARRHYTHMIAS CB HO
73112 ECG Interpretation: An Incredibly Visual! Pocket Guide SPRINGHOUSE
73120 The Only EKG Book You'll Ever Need, 6 Ed
THALER
73507 FEIGENBAUMS ECHOCARDIOGRAPHY 7E CB ARMSTRONG
73515 KAPLANS CLINICAL HYPERTENSION 10E CB
KAPLAN
73537 DUPLEX SCANNING VASCULAR DISORD 4E CB ZIERLER
2009 24522.00 2009 1502.00 2008 2867.00 2008 6465.00 2008 3233.00 2008 3782.00 2008 15738.00 2007 1459.00 2009 2745.00
2009 6099.00
2009 2745.00
2009 11590.00 2003 1080.00 1998 2160.00
2009 3049.00 2009 2898.00
2009 2008 2009 2009 2009
13054.00 14152.00 4025.00 4147.00 14152.00
2009 5489.00 2008 12955.00 2009 16195.00 2009 4855.00 2009 6466.00 2009 21884.00 2009 24766.00 2009 20618.00 2009 8052.00 2009 2434.00 2009 2745.00 2009 15982.00 2009 8052.00 2009 14518.00 49 od 116
73537 DUPLEX SCANNING VASCULAR DISORD 4E CB 73561 PRACTICAL GUIDE FETAL ECHOCARDIO 2E PB 73630 AUSCULTATION SKILLS BREATH HEART 4E PB 74204 Oxford Handbook of Cardiology and Emergencies in Cardiology Pack (2/e) 74389 Neurovascular Medicine 74390 Adult Congenital Heart Disease 74392 Organ Donation and Transplantation after Cardiac Death 74695 LANGE Instant Access EKGs and Cardiac Studies 74697 Physical Examination of the Heart and Circulation 74720 Peripheral Arterial Disease 74980 An Introduction to Cardiovascular Physiology Fifth Edition 74993 Emergency Cardiology Second Edition 75323 Nadas' Pediatric Cardiology, 75869 .DUGLRORJLMDXUDGXRSгWHPHGLFLQHSRURGLюQH medicine 76169 .OLQLюNDNDUGLRYDVNXODUQDIDUPDNRORJLMD 77851 Cases in Adult Congenital Heart Disease Expert Consult: Online and Print, 77916 Fetal Echocardiography, 79008 Cardiovascular Magnetic Resonance,2ed 80313 6UюDQHDULWPLMHHOHNWURIL]LRORJLMDNOLQLюNH NDUDNWHULVWLNHGLMDJQRVWLNDOHюHQMH 80793 Vaskularni ultrazvuk 80985 Congenital Heart Defects 80987 Cardiovascular Magnetic Resonance 81029 Atlas of Cardiac Surgical Techniques, 81289 Core Topics in Transesophageal Echocardiography 81361 The Cardiovascular System,2 Ed 81493 Oboljenja vena : sta treba znati o venama da bi lakse i duze ziveli 81494 Kako lakse i duze ziveti sa obolelim srcem : mali SULUXюQLN]DEROHVQLNHLVYHRQHNRMLWRQHеHOHGD postanu 81821 Echocardiography Pocket Guide: The Transthoracic Examination 82415 Noninvasive Peripheral Arterial Diagnosis 109419 Knjiga o stresu 109686 Manual of Cardiovascular Medicine, 3e 109703 PATHOPHYS HEART DISEASE 5E (INT ED) PB 109995 Cardiac Anaesthesia 109996 Cardiac Electrophysiology and Catheter Ablation 110342 Pulmonary Arterial Hypertension 110344 Oxford Textbook of Interventional Cardiology
ZIERLER ABUHAMAD SPRINGHOUSE Ramrakha, Punit; Hill, Jonathan; Myerson, Saul G.; Maiese, Kenneth Thorne, Sara; Clift, Paul Talbot, David; D'Alessandro, Anthony Anil M. Patel Joseph K. Perloff Robert S Dieter, Jr., Raymond A. Dieter, Iii, Raym J Rodney Levick Dr. Kareim Ratib John F. (Barry) Keane 0LUMDQD/DSюHYLь'DQH дLJLь6X]DQD 6WDQNRYLь'UDJR .DеLь Michael A. Gatzoulis Julia A. Drose Warren J. Manning *UXMLь0LRGUDJDXWRU %RULV%UNOMDюLь Wyszynski, Diego; Graham, Thomas; Correa-Villaseno Myerson, Saul G.; Francis, Jane; Neubauer, Stefan Frank Sellke Feneck/Kneeshaw/Ranucci Alan Noble 9XюLQLь0LKDLORDXWRU 9XюLQLь0LKDLORDXWRU Bulwer 6WRеLQLь6YHWRPLU3DXWRU Griffin LILLY Barnard, Matthew; Martin, Bruce Bashir, Yaver; Betts, Timothy R.; Rajappan, Kim Handler, Clive; Coghlan, Gerry Redwood, Simon; Curzen,
2009 2009 2009 2009
14518.00 10492.00 4514.00 5621.00
2009 10879.00 2009 4746.00 2009 9379.00
2009 2009 2009
2073.00 7319.00 9759.00
2009 3659.00 2010 2683.00 2006 10247.00 2005 1333.00
2009 2700.00 2009 13420.00
2009 7807.00 2010 11833.00 2009 2700.00
2010 4900.00 2010 10629.00
2010 4996.00
2009 2010 2010 2010
20496.00 8540.00 3049.00 160.00
2010 160.00
2010 4513.00
2010 2009 2010 2010 2010
3396.00 281.00 6099.00 3477.00 4996.00
2010 4746.00
2010 1749.00
2010 11880.00 50 od 116
Nick; Thomas, Martyn R.
110357 Harrison's Cardiovascular Medicine
Joseph Loscalzo
110751 3UDNWLюQDHOHNWURNDUGLRJUDILMD
,OLь6WHYDQ1DXWRU
110875 Tumori srca
Rafajlovski, Saso - autor
111588 Endovascular Surgery,
Wesley S. Moore
111623 Netter's Cardiology,2ed
Marschall S. Runge
111630 Diagnosis and Management of Adult Congenital Heart Michael A. Gatzoulis Disease,2ed
111645 heart failure: A Companion to Braunwald's Heart Disease: Expert Consult - Online and Print, 2 Ed
Douglas L. Mann
111647 Acute Coronary Syndromes: A Companion to Braunwald's Heart Disease, 2nd Edition Expert Consult - Online and Print
Pierre Theroux
111722 Dynamic Echocardiography,
Roberto M. Lang
111766 Cases in Interventional Cardiology,
Michael Ragosta
112143 INTRODUCTORY GUIDE CARDIAC CATH 2E PB ASKARI / AVILES
112144 MANUAL PERIPHERAL VASCULAR INTERVENT CB CASSERLY
112373 $5,70,-(8/,-(э1,э.2-35$.6,
MIJO BERGOVEC I DR
112747 Cardiac Imaging [With Access Code] (RadCases)
113210 Heart Valve Surgery: An Illustrated Guide
Jan Dominik, Pavel Zacek
113211 Cardiovascular Critical Care
Griffiths M
113454 Echocardiography
113935 Drugs in Cardiology
Kaski, Juan Carlos; Hayward, Carl; Mahida, Saagar;
113936 Integrative Cardiology
DeVries, Stephen; Dalen, James
113937 Heart Disease
Chenzbraun, Adrian
113938 Hitchhiker's Guide to Internal Medicine
Qasim, Atif
114013 Practical Handbook of Echocardiography - 101 Case Sun JP Studies
114020 Live/Real Time 3D Echocardiography
Nanda NC
114024 Pediatric Cardiology 2e
Johnson W
114350 CARDIOVASCULAR CARE MIE UK EDITION PB CARLINE
114590 Braunwald's Heart Disease: a Textbook of Cardiovascular Medicine, Single Volume,
Robert O. Bonow
114734 VALVULAR HEART DISEASE
PB
ANDRUS
114843 Hypertension
Cheriyan, Joseph; McEniery, Carmel; Wilkinson, Ian
115018 Cardiac Biomarkers In Clinical Medi
Januzzi
115063 Cardiology,
Alexander Lyon
115215 Peripheral Vascular Disease
Alonso
115222 The Ecg Criteria Book 2e
O'keefe
115473 Mйmo cardio en urgence
Frйdйric Lapostolle, JeanPierre Torres
115580 The ESC Textbook of Intensive and Acute Cardiac Care ()
Tubaro, Marco; Danchin, Nicolas; Filippatos, Geras
116140 Vascular and Endovascular Surgery,
Jonathan D. Beard
117451 PRACTICAL CARDIOVASCULAR PATHOLOGY CB BURKE
117589 *sp* Braunwald's Heart Disease: A Textbook of Cardiovascular Medicine, International Edition, 9th Edition
Bonow, Mann, Zipes & Libby
2010 2009 2010 2010 2010 2010
5245.00 1620.00 3456.00 19642.00 7929.00 14152.00
2010 12566.00
2010 12566.00
2010 2010 2010 2010 2010 2010 2010 2010 2009 2010
15738.00 7807.00 5124.00 10980.00 1787.00 4855.00 18138.00 9149.00 14736.00 4996.00
2010 3439.00
2010 2010 2010
1249.00 3439.00 9515.00
2010 2008 2010 2011
20618.00 5611.00 3044.00 19642.00
2010 3654.00 2009 4746.00
2009 2010 2010 2010 2010
5611.00 2561.00 2195.00 1951.00 2025.00
2010 21884.00
2009 9149.00 2010 18422.00 2011 9999.00
51 od 116
Edition
118792 Postgraduate Vascular Surgery
Bhattacharya/Stansby
119695 Cerebrovaskularne bolesti
6YHWRPLU3,YDQRYLь
komplementarna medicina
3776 Massage Therapy: The evidence for practice
Grant Jewell Rich
10717 Encyclopedia of Remedy Relationships in Homoeopathy
Abdur Rehman
10718 The ABC Clinical Guide to Herbs
Mark Blumenthal
17506 Pocket Guide to Herbal Medicine
Karin KraftiChristopher Hobbs
25485 Imagine Homeopathy
Kurz
26618 $.835(685$,/,356727,6$.3ULUXюQLN
Vjenceslav Kiseljak
43921 ABC of Complementary Medicine
Zollman, Catherine
48433 Homeopathic Prescribing Pocket Companion
Kayne, Lee R.; Kayne, Steven B.
49953 Velika knjiga prirodnih terapija, 285 str.
52008 Complementary Therapies for Physical Therapy
Judith Deutsch
53819 Homeopathic Practice
Edited by Steven B Kayne
56142 Massage Therapist's Guide to Pathology
WERNER
59849 Oxford Handbook of Complementary Medicine
Ernst, Edzard; Pittler, Max H; Wider, Barbara; Bod
60047 Color Atlas of Acupuncture: Body Points - Ear Points - Hans-Ulrich Hecker,
Trigger Points, 2 Ed (Complementary Medicine
Angelika Steveling, Elmar
(Thieme))
Peuk
67763 7LEHWDQVNDPHGLFLQDHKRLVюH]OHFLYLOL]DFLMH
3HWURYLь6UHWHQDXWRU
71702 Treating Autoimmune Disease with Chinese Medicine, Wanzhu Hou
71771 Pediatric Manual Medicine: An Osteopathic Approach Jane Carreiro
2011 4636.00 2010 7560.00
2002 4025.00 2003 5935.00
2003 7555.00 2004 3775.00
2005 2005 2007 2007
4315.00 1750.00 2439.00 2812.00
2008 2008 2008 2008
1628.00 4879.00 4477.00 3166.00 3745.00
2008 3775.00
2007 2009 2009
432.00 4879.00 4757.00
71778 An Osteopathic Approach to Children,2 Ed
Jane Carreiro
71780 Botanical Medicine for Women's Health,
Aviva Romm
71782 A Materia Medica for Chinese Medicine: plants, minerals and animal products
Carl-Herman Hempen
71815 The Complete Stems and Branches: Time and Space Roisin Golding in Traditional Acupuncture
71816 Atlas of Shiatsu,
Wilfried Rappenecker
71888 Complementary and Alternative Medicine (Second edition)
Edited by Steven B Kayne
72380 Pocket Atlas of Chinese Medicine
Marnae C. Ergil, Kevin Ergil
72382 The Patient-Practitioner Relationship in Acupuncture Leon I. Hammer (Complimentary Medicine)
72398 Trigger Points and Muscle Chains in Osteopathy (Complementary Medicine (Thieme))
Philipp Richter, Eric Hebgen
72461 Health through Inner Body Cleansing: The Famous F. Erich Rauch X. Mayr Intestinal Therapy from Europe
72463 Lymphedema Management
Joachim E. Zuther
72559 Introduction to Bioregulatory Medicine
Alta Smit, Arturo O\\\'Byrne, Bruno Van Brandt, Iv
73543 MEDICAL ACUPUNCTURE MUSCUL MEDICINE PB COOPER
81928 Elektromagnetno polje i bioloski sistemi
=HюHYLь/XNRYLь7DQMD autor
108893 Lek za sve vrste kancera
Klark, Hulda Reger - autor
108894 Lek za sve vrste uznapredovalih kancera
Klark, Hulda Reger - autor
108895 Lek i prevencija za sve vrste kancera (sadrzi i dvd)
Natasa Koderman
2009 2009 2009 2008 2008 2008 2009 2008 2008 2008 2009 2009 2009 2008 2009 2009 2009
5611.00 4147.00 6099.00 5977.00 3903.00 4477.00 4315.00 3235.00 7555.00 1939.00 6475.00 7015.00 4026.00 1404.00 1296.00 1296.00 1620.00
52 od 116
110108 Acupuncture in Manual Therapy,
Jennie Longbottom
111550 Palpation and Assessment Skills,
Leon Chaitow
112726 The Art of Cupping (Complementary Medicine (Thieme Hedwig Manz Paperback))
113216 Kvantno hologramska medicina : kroz prizmu akupunkturnih i mikrotalasno rezonatnih (samo) regulatorinih mehanizama
-RYDQRYLь,JQMDWLь=ODWD autor
114594 Practice Handbook of Acupuncture,
Gertrude Kubiena
114596 Chinese Herbal Formulas: Treatment Principles and Yifan Yang Composition Strategies,
115040 Shiatsu Theory and Practice,
Carola Beresford-Cooke
116651 Yamamoto New Scalp Acupuncture, w. DVD
Richard A. Feely
119839 Lekovite gljive protiv raka i drugih oboljenja
Georgiev, Georgi - autor
120094 5DNPRеHELWLL]OHюHQVDDORMRPDUERUHVFHQV
Nikolaj Kolev
medicina rada
9932 *sp* Medical Ethics and Law: The Core Curriculum Hope
18905 Medicinska sociologija
Gordana Cerijan
18930 Medicina rada
'XQMD'HULWLь6WDKLOMDN
19382 Medicina rada i okolisa
37823 95612ы$0(',&,16.(6.5%,
Reuben Eldar
73919 Oxford Handbook of Occupational Health
Smedley, Julia; Dick, Finlay; Sadhra, Steve
74983 100 Cases in Clinical Ethics and Law
Carolyn Johnston
PHGLFLQVNLUHюQLFL
8339 9HWHULQDUVNLUHюQLN
Nevenka Bjelica
18816 5LMHюQLNODWLQVNRJLKUYDWVNRJPHGLFLQVNRJQD]LYOMD
Vladimir Loknar
19616 HRVATSKO - ENGLESKI I ENGLESKO - HRVATSKI Vlasta Tanay 5-(э1,.0(',&,16.2*1$=,9/-$6,=*292520 3UYLGYRMH]LюQLUMHюQLNPHGLFLQVNRJQD]LYOMD
44278 *sp* Dorland's Illustrated Medical Dictionary 31e
Dorland
44873 LATINSKE I HRVATSKE MEDICINSKE IZREKE
47831 Oxford Dictionary of Sports Science and Medicine (3/e) Kent, Michael
47956 A Dictionary of Food and Nutrition (2/e)
Bender, David A.
55090 Dorland's Pocket Medical Dictionary 28e IE
Dorland
2010 2010 2008 2010 2009 2010 2010 2010 2009 2009 2003 2003 2002 2007 2008 2002 2003 1999 2007 2007 2006 2005 2008
4391.00 4879.00 4315.00 2160.00 5123.00 6099.00 6099.00 7015.00 432.00 432.00 400.00 2100.00 1260.00 7000.00 1120.00 4120.00 2439.00 1620.00 7000.00 3500.00 1999.00 1750.00 999.00 1499.00 2185.00
59383 0HGLFLQVNLUHюQLNODWLQVNRVUSVNLLVUSVNRODWLQVNL 59962 Medical Terminology: A Short Course 65238 More Medical Words You Need 67240 Medicinske izreke i poslovice zdravlje u rukama coveka 67759 Engleski za zdravstvene radnike 68283 1D]LYLEROHVWLLSRUHPHьDMDXHQJOHVNRPLVUSVNRP jeziku 68459 Medicinska terminologija - latinski jezik : za studente medicine 69090 Dictionary Of Virology 69705 9LгHMH]LюNLPHGLFLQVNLUHюQLN /H[LFRQPHGLFXP polyglottum 71645 Medical Terminology Online for Basic Medical Language (User Guide, Access Code, and Textbook Package),
0LOH0HGLь Davi-Ellen Chabner Arneri-Georgijev, Jelisaveta - autor Jovica Lucanin, Budimir Pavlovic, Marija Doncev 'UDJRYLь5DGPLODDXWRU 0LьLь6RILMDDXWRU 0DWLь5DGPLODDXWRU Mahy, B .RVWLь$OHNVDQGDU autor Myrna Lafleur Brooks
2005 2008 2005
702.00 2561.00 540.00
2002 324.00
2005 2004
378.00 756.00
2006 1296.00
2008 2922.00 2009 9180.00
2009 5123.00
53 od 116
71647 Medical Terminology Online for Basic Medical
LaFleur Brooks & LaFleur
Language (User Guide and Access Code), 3rd Edition Brooks
71653 Basic Medical Language,
Myrna Lafleur Brooks
74184 Illustrated Dictionary of Biotechnology
Arora
74185 Illustrated Dictionary of Immunology 3ed
Cruse
74979 Radiological Sciences Dictionary: Keywords, names David Dowsett and definitions
75828 (1*/(6.2+59$76.,0(',&,16.,5-(э1,. SVEZAK I / A-L (sifra 040214)
BRANIMIR JERNEJ
114496 Medical Language Instant Translator,
Davi-Ellen Chabner
114688 Concise Colour Medical Dictionary (5/e)
Martin, Elizabeth A.
mikrobiologija
4133 *sp* BRS MICROBIOLOGY IMMUNOLOGY 4/E
JOHNSON
4763 *sp* The Springer Index of Viruses
Tidona, Darai
7215 Medical Microbiology and Infection at a Glance -IE
Gillespie
7226 Basic Virology- 2 Ed -IE
Wagner
9517 *sp* The Pathological Protein
Yam
14468 *sp* Encyclopedia of Virology vol. I,II,III
Allan Granoff,Robert G Webster
15911 Molecular Microbiology Laboratory: A Writing-Intensive Ream Course - IE
18825 Medicinska bakteriologija
Henrik Weisglass
18922 Molekularna biologija u medicini
Timothy M.Cox
19852 A Dictionary of Virology (3rd Edition)
Brian W. J. MahyiBrian Mahy
20889 Bergey's Manual of Systematic Bacteriology : Volume George Garrity 2: The Proteobacteria (Part C)
21562 Bergey's Manual of Systematic Bacteriology: Firmicutes v. 3 (Bergey's Manual of Systematic Bacteriology (Springer-Verlag))
25478 *sp* Bacterial Ion Channels and Their Eukaryotic Homologs
Kubalski
26097 Koneman's Color Atlas and Textbook of Diagnostic Microbiology, 6 Ed
KONEMAN / WINN
26824 Molecular Basis of Virus Evolution
Gibbs/Calisher/Garcia
27426 Principles of Molecular Virology (Standard Edition), 4th Cann edition
30874 *sp* Quasispecies: Concept and Implications for Virology
E. Domingo
31515 VIRUSNI HEPATITIS
3$/029,ы'5$*$1
34775 Lecture Notes: Medical Microbiology, 4 Ed - IE
Elliott
35391 Medical Microbiology
Fritz H. Kayser, Kurt A. Bienz, Johannes Eckert
35731 Lippincott's Illustrated Reviews: MICROBIOLOGY 2E CHAMPE/HARVEY
36651 APPLETON & LANGE OUTLINE REVIEW OF MICROBIOLOGY & IMMUNOLOGY, 4 ED - IE
YOTIS
43808 Underground Clinical Vignettes STEP 1 MICROBIOLOGY
SWANSON
43809 Underground Clinical Vignettes STEP 1 MICROBIOLOGY
SWANSON
43892 Prescott's Microbiology
Willey, Joanne
43914 Foundations in Microbiology
Talaro, Arthur
2009 2805.00
2009 2009 2009 2009
3659.00 4147.00 7441.00 3659.00
2006 4690.00
2010 1829.00 2010 1749.00
2001 2001 2000 2003 2003 1999
500.00 15820.00 1342.00 2928.00 2717.00 21197.00
2003 2803.00
1994 2000 2001
1582.00 5600.00 6221.00
2005 14767.00
2009 24835.00
2005 6618.00
2005 6710.00
2005 5490.00 2005 4757.00
2005 5950.00
2004 2006 2004
2125.00 1647.00 4315.00
2006 3044.00 2005 1707.00
2007 1336.00
2007 1336.00
2007 5489.00 2006 4391.00 54 od 116
43984 Bailey & Scott's Diagnostic Microbiology 12E IE
Forbes
2007 5054.00
44008 MEDICAL MICROBIOLOGY 17E IE 48405 Mims' Medical Microbiology, 4th edition 48493 Microbial Life 2e 50389 Rapid Review Microbiology and Immunology, 53283 Biotechnology for Beginners 55222 Brock Biology of Microorganisms:International Edition 12ed 55228 Microbiology with Diseases by Body System:International 2ed 55916 Microbiology: Principles and Explorations,7 Ed (WIE) 56373 Medicinska bakteriologija 56807 Therapeutic Microbiology: Probiotics and Related Strategies 56877 Chemistry of Fungi 59919 Clinical Microbiology and Infectious Diseases: An Illustrated Colour Text 61379 Basic Virology 3e 62026 Topley and Wilson's Microbiology and Microbial Infections 10e: Immunology 62027 Topley and Wilson's Microbiology and Microbial Infections 10ed Cd Rom 62063 Topley and Wilson's Microbiology and Microbial Infections 10e: Virology 2-Volume Set (incl free Cd) 62065 Topley and Wilson's Microbiology and Microbial Infections 10e: Cumulative Index 63443 Medical Microbiology, 6 Ed with STUDENT CONSULT Online Access
Greenwood Richard Goering Staley et al Ken Rosenthal Reinhard Renneberg Michael Madigan John Martinko Paul Dunlap David Cl Robert Bauman Black JG 0LOHQDвYDELь9ODKRYLь W. John Spicer Wagner EK Stefan H E Kaufmann Brian W J Mahy Brian W J Mahy Patrick R. Murray
2007 2008 2007 2007 2007 2008
3005.00 5367.00 5611.00 3171.00 2434.00 5394.00
2008 5826.00 2008 5240.00 2008 1188.00 2008 10248.00 2008 7686.00 2007 4147.00 2007 4269.00 2007 25498.00 2006 127978.00 2007 38430.00 2007 610.00 2008 6099.00
67661 Oxford Handbook of Infectious Diseases and Microbiology
Torok, Estee; Moran, Ed; Cooke, Fiona
69090 Dictionary Of Virology
Mahy, B
70785 Microbiology:An Introduction: International Edition 10ed Gerard Tortora Berdell Funke Christine Case
71064 Medical Microbiology and Immunology Flash Cards, Ken S. Rosenthal Updated Edition,
73001 Fungi and Food Spoilage
John I. Pitt, Ailsa D. Hocking
73595 BRS: MICROBIOLOGY AND IMMUNOLOGY 5/E
BRS (JOHNSON)
2009 3250.00 2008 2922.00 2009 5476.00 2008 2927.00 2009 11334.00 2009 2928.00
75559 Review of Medical Microbiology and Immunology, 10th Warren Levinson Edition
76341 Sherris Medical Microbiology
Ryan
76675 Molecular Biotechnology 4e - Principles and Applications of Recombinant DNA
Glick BR
109695 BURTONS MICROBIO HEALTH SCI 9E INT ED PB ENGELKIRK
109774 REVIEW OF MEDICAL MICROBIOLOGY AND IMMUNOLOGY IE- 11 Ed
LEVINSON
110868 Textbook of Diagnostic Microbiology, 4th Edition
Connie R. Mahon
111731 Rapid Review Microbiology and Immunology,3ed
Ken S. Rosenthal
112429 LANGE Flash Cards: Microbiology and Infectious
Kenneth D. Somers,
2008 2439.00 2010 2745.00 2010 10974.00
2010 3415.00 2010 2751.00
2010 2010 2010
8661.00 3171.00 3293.00
55 od 116
Diseases, Second Edition
Stephen A. Morse
113314 Jawetz, Melnick & Adelberg's Medical Microbiology BROOKS
114776 Schaum's Outline of Microbiology
Alcamo
116065 Molecular Detection of Human Viral Pathogens
Liu
119298 Deja Review Microbiology & Immunology, Second Edition
Eric Chen, Sanjay Kasturi
molekularna medicina
18922 Molekularna biologija u medicini
Timothy M.Cox
63445 Molecular Modelling for Beginners 2e
Hinchliffe A
63497 Biochemistry and Molecular Biology (4/e)
Elliott, William H.; Elliott, Daphne C.
69594 ODABRANE METODE MOLEKULARNE BIOLOGIJE 1LYHV3HьLQDвODXVL suradnici
nefrologija
5691 The Kidney at a Glance - IE
O'Callaghan; Brenner
7235 Nephrology - IE
RCP
14583 Kidneys, Ureters and Urinary Bladder (Netter Collection Frank H. Netter of Medical Illustrations, Volume 6)
18871 Bubrezna osteodistrofija
Ivan Labos
35713 HIGH-YIELD SYSTEMS KIDNEY
DUDEK
36491 Oxford Handbook of Nephrology and Hypertension Steddon, Simon
39734 *sp* DISEASES OF THE KIDNEY 8E
SCHRIER
55082 Brenner and Rector's The Kidney, 8th Edition 2-Volume Set
Barry Brenner
55700 Transplatacija bubrega
55723 Bolesti bubrega
60034 Kidney Transplantation: Principles and Practice
Peter Morris, Stuart J. Knechtle
61937 /HNDUVNLSULUXюQLNL]GHюMHQHIURORJLMH
3RSRYLь5RORYLь0LODQD autor
62170 Transplantacija bubrega
9LгQMD/HеDMLь/MXELFD XNDQRYLь
65971 Biohemijski markeri i diferencijalna dijagnostika u QHIURORJLMLYRGLюNUHDWLYQHGLMDJQRVWLNHVWHSE\VWHS SURWRNROUHгDYDQMHGLMDJQRVWLюNLKGLOHPDSULPHQD racionalne reanimacije
9XNXгLь=YRQLPLUDXWRU
66437 LANGE INSTANT ACCESS: ACID-BASE, FLUIDS & Reilly ELECTROLYTES
66475 The Washington Manual Nephrology Subspecialty Consult, 2Ed
WASHINGTON UNIV
66502 Oxford Handbook of Dialysis (3/e)- IE
Levy, Jeremy; Brown, Edwina; Daley, Christine; Law
66723 MANUAL OF NEPHROLOGY 7E-ISE
SCHRIER
66724 HANDBOOK NEPHROLOGY & HYPERTENSION 6E WILCOX PB -ISE
70884 Current Essentials of Diagnosis & Treatment in Nephrology & Hypertension 1ed ISE
Edger Lerma, Jeffrey Berns, Allen Nissenson
2010 2009 2010 2010
2757.00 1463.00 15494.00 1951.00
2000 2008 2009
5600.00 4264.00 3000.00
2009 1750.00
2000 2003 2000
1159.00 2440.00 6460.00
2004 2006 2006 2006 2007
1836.00 1464.00 2875.00 22973.00 36966.00
1307.00 1999 779.00 2008 21350.00
2001 540.00
2004 1307.00
2008 648.00
2008 1702.00 2008 2867.00 2009 3000.00 2008 3904.00 2008 3904.00 2009 3294.00
71900 Introduction to Renal Therapeutics - First Edition 73122 HANDBOOK OF NUTRITION AND KIDNEY 6E PB 74207 Chronic Kidney Disease ()
C. Ashley and C. Morlidge MITCH El Nahas, Meguid; Levin, Adeera
2008 2009 2009
3837.00 4026.00 4996.00
56 od 116
77448 Bolesti bubrega
XNDQRYLь/-XELFDDXWRU
77867 Primer on Kidney Diseases,5 Ed
Arthur Greenberg
81360 The Renal System,2 Ed
Michael J. Field
81986 RENAL ELECTROLYTE DISORDERS 7E PB
SCHRIER
82089 Harrison's Nephrology and Acid Based Disorders
Jameson
83025 Pocket Companion to Brenner and Rector's The Kidney,
Michael R. Clarkson
110529 +HPRUDJLюQDJUR]QLFDVDEXEUHеQLPVLQGURPRP
=RUDQ.RYDюHYLь'UDJDQ -RYDQRYLь
111656 Comprehensive Clinical Nephrology,
Jurgen Floege
neurologija
4088 Handbook of Diagnostic and Therapeutical Spine Procedures
Alan L. Williams
4217 Color Atlas of Neuroscience
Greenstein
4773 *sp* What Your Doctor May Not Tell You About
Fox, Barry, Phd; Fox,
Migraines: The Breakthrough Program That Can Help Barry; Mauskop, Alexander,
End Your Pain
5785 *sp* UCV - Neurology
Bhushan
7208 Neuroscience at a Glance, 2 Ed - IE
Barker
7351 *sp* Spine Secrets
Devlin
8538 Illustrated Atlas of the Techniques of Neural Therapy Dosch with Local Anesthetics, 2 Ed
9517 *sp* The Pathological Protein
Yam
11477 Color Atlas of Neurology
Rohkamm
13499 The Cranial Nerves
Doyon; Francke
14576 Nervous System: Anatomy and Physiology (Netter Collection of Medical Illustrations, Volume 1, Part 1)
Frank H. Netter
14577 Nervous System: Neurologic and Neuromuscular Disorders (Netter Collection of Medical Illustrations, Volume 1, Part 2)
Frank H. Netter
16747 *sp* Manual of Neurological Therapeutics, 7 Ed - IE Samuels, Martin A.
18043 *sp* Blood-Spinal Cord and Brain Barriers in Health and Disease
Hari Shanker SharmaiJan Westman
18872 Osnove smrti mozdanog debla
Pallis
19596 NEUROTRANSMITORI U ZDRAVLJU I BOLESTI
=GUDYNR/DFNRYLь
20199 *sp* Principles Of Treatment In Parkinson's Disease Anthony H. V. SchapiraiC Warren MD Olanow
20721 *sp* Russell and Rubinstein's Pathology of Tumours of Bigner the Central Nervous System 6edition, 2 Volume
23159 *sp* TREATMENT OF EPILEPSY 4E CB
WYLLIE
24056 *sp* DeJong's the Neurologic Examination
Campbell, William W.
24214 *sp* MERRITTS NEUROLOGY 11E, IE
ROWLAND
26615 1(852,1)(.&,-(3ULUXюQLN
Ivan Soldo, Jasmina Timarac
2007 2009 2010 2010 2010 2010
540.00 6831.00 3049.00 6466.00 6343.00 4635.00
2008 540.00
2010 17324.00
2002 6221.00 1999 3775.00 2001 400.00
1999 2003 2003 2003
400.00 1342.00 1450.00 10692.00
2003 2003 2004 2000
2717.00 4315.00 4264.00 6460.00
2000 6460.00
2004 2003
500.00 900.00
2002 2005
1120.00 2212.00 3568.00
1998 900.00
2005 2005 2005 2005
7564.00 3904.00 5124.00 1400.00
27117 Pediatric Neurology, 4th edition 32123 Urgentna neurologija 34674 Current Diagnosis and Treatment: Neurology - ISE 36082 MERRITTS HANDBOOK OF NEUROLOGY 2 36216 Lancet Handbook of Treatment in Neurology 36234 Netter's Atlas of Human Neuroscience-IE 36512 Oxford Handbook of Neurology
Kenneth Swaiman 5DGRMюLь%RULYRMH Brust MAZZONI / ROWLAND Warlow Felten Manji, Hadi
2006 2002 2006 2006 2006 2003 2006
36234.00 389.00 3166.00 3654.00 1365.00 2595.00 3375.00
57 od 116
37592 NEUROTRAUMATOLOGIJA 38952 *sp* Hypocretins: Integrators of Physiological Signals 39726 PARKINSONS DISEASE MOVEMENT DISO 43449 Practical Electrotherapy 43770 MGH MANUAL OF NEUROLOGY 2E 43959 Functional and Molecular Imaging of Stroke and Dementia: Updates in Diagnosis, Treatment, and Monitoring 43980 Clinical Neuroanatomy and Neuroscience, With STUDENT CONSULT online access,5 Ed - IE
Kresimir Rotim i suradnici JANKOVIC John Fox FLAHERTY Tsunehiko Nishimura FitzGerald
2006 2005 2006 2007 2007 2006
2100.00 6234.00 9150.00 2927.00 2928.00 10799.00
2007 2731.00
47349 Atlas of Anatomy. Head and Neuroanatomy (Thieme Atlas of Anatomy) 47359 Comprehensive Board Review in Neurology 47390 High-yield Brain and Behavior: 4 (High-Yield Systems Series): 4 (High-yield Systems) 47395 Clinical Neurology: From the Classroom to the Exam Room 47443 Epilepsy: A Comprehensive Textbook, three volumes 47466 First Exposure to Neurology ISE 48350 Netter's Concise Neurology, 48374 STROKE A PRACTICAL APPROACH 48400 Textbook of Clinical Neurology , 3rd edition 48895 Neurology Board Review An Illustrated Study Guide 49009 Mayo Clinic Medical Neuroscience Fifth Edition Organized By Neuro 49902 0RеGDQLNUYRWRNNOLQLюNLSULVWXSVWU 49939 Funkcijska anatomija lokomotornog sustava, 600 str. 50095 NEUROKIRURGIJA 50827 Imaging of the Nervous System 51664 Fundamental Neuroscience, 54458 Cellular and Molecular Neurophysiology,3 Ed 55091 Neurological Examination Made Easy 4e IE 55120 Neonatology: Questions and Controversies Series: Neurology 55504 Rapid Review Neuroscience, 55718 ,VKHPLюNDEROHVWPR]JD 55719 Infekcije nervnog sistema 55726 Osnovi neurohirurgije 55733 (SLOHSVLMDLHSLOHSWLюNLVLQGURPL 55737 Povrede i oboljenja perifernih nerava 56034 Principles and Practices of Unbiased Stereology 57998 Neurologija za stomatologe 59049 Peripheral Nerve Blocks, A Color Atlas, 3e 59941 Essentials of the Human Brain With STUDENT CONSULT Online Access
Michael Schьnke, Erik Schulte, Udo Schumacher Mark K. Borsody Barbara Fadem; Edward A. Monaco Jeffrey W. Clark Jerome Engel, Timothy A. Pedley, Jean Aicardi Kirshner, Howard S. Karl Misulis GOMEZ Christopher Goetz Mowzoon Nima Benarroch Eduardo E Predrag Keros, Marko 3HьLQD 9ODGLPLU-вLPXQRYLь Richard Latchaw Larry R. Squire Constance Hammond Fuller Jeffrey Perlman James Weyhenmeyer дLYNRYLь0LURVODYDвWHUQLь 1DGHеGD.RVWLь9ODG 0LURVODY6DPDUGеLь 6DPDUGеLь0LURVODY Mouton Demarin, Trkanjec CHELLY Jack Nolte
2007 6475.00
2006 7555.00 2007 1281.00
2007 2623.00
2007 28060.00
2007 2007 2007 2007 2007 2007
1964.00 3415.00 9516.00 14152.00 10370.00 6100.00
1257.00 2007 5903.00
2007 2005 2008 2008 2008 2008
5180.00 27694.00 7075.00 5977.00 1775.00 6831.00
2006 3171.00 2000 714.00
2000 1998 1998 2002 2008 2008 2009
1103.00 584.00 519.00 584.00 3111.00 2786.00 6954.00 3049.00
59964 Cerebrospinal Fluid in Clinical Practice 59974 Brain Imaging,
David N. Irani Laurie A. Loevner
2008 12322.00 2008 4025.00
58 od 116
59991 Neurosurgery Practice Questions and Answers
Mark Shaya, Remi Nader, Anil Nanda
59992 Plastic Techniques in Neurosurgery
James T. Goodrich, Kalmon D. Post, Ravelo V. Argam
59994 Operative Neurosurgical Anatomy
Damirez Fossett, Anthony J. Caputy
60001 Neurosurgical Intensive Care: The Essentials
Javed Siddiqi
60039 Atlas of Spine Trauma with CD-ROM: Adult & Pediatric Daniel H. Kim, Steven C. Ludwig, Alexander R. Vacc
60548 BASIC CLINICAL NEUROSCIENCE 2E PB
YOUNG
60617 WEINER AND LEVITTS NEUROLOGY 8E PB
RAE-GRANT
60729 CLINICAL NEUROSURGERY VOL 54
CB
MCKHANN
60758 Mayo Clinic Essential Neurology
61120 Greenfield's Neuropathology Eighth Edition 2-Volume Prof Seth Love Set
61716 1HXURORгNLSUHJOHGLRVQRYLNOLQLюNHQHXURORJLMH
5DGRMLюLь%RULYRMH0 autor
61725 .OLQLюNDQHXURORJLMD
5DGRMLюLь%RULYRMH0 autor
61995 /HюHQMHHSLOHSVLMH
0DUWLQRYLьдDUNRDXWRU
62032 Computer Aided Tomography Case Histories of the Brain
Dr Karthikeyan
62034 Russell & Rubinstein's Pathology of Tumors of the Nervous System, 7th Edition
Mclendon et al
62042 Dementia 3rd Edition
Alistair Burns
62051 Adams and Graham's Introduction to Neuropathology, Professor D I Graham Third Edition
62057 Oppenheimer's Diagnostic Neuropathology 3rd Edition Margaret Esiri
63666 Stroke Part I: Basic and epidemiological aspects,92 Marc Fisher
63667 Stroke Part Ii: Clinical manifestations and pathogenesis,93
Marc Fisher
63668 Stroke Part Iii: Investigation and management,94
Marc Fisher
65427 EXPERT DIFF DIAG: BRAIN SPINE AMIRSYS CB OSBORN
65660 Sensation and Perception
Wolfe et al J.
65922 .OLQLюNDQHXURRWRORJLMD
Haralampiev, Kiril - autor
65934 Neuroloski simptomi i sindromi u psihijatriji
9HOLюNRYLь$OHNVDQGDU autor
65984 Urgentna stanja u neurologiji
9HOLюNRYLь$OHNVDQGDU autor
66066 Psihoneuroimunologija
0LOLYRM%RUDQLь
67028 PEDIJATRIJSKA NEUROLOGIJA
1LQD%DULгLьLVXUDGQLFL
68251 Multiplaskleroza
$]UD.XUWRYLь$ODMEHJRYLь
68275 Cerebrovaskularne bolesti
Milan Arbutina
68518 Adams and Victor's Principles of Neurology, 9 Ed - IE Allan H. Ropper, Martin A. Samuels
68844 Community Treatment of Drug Misuse: More Than Methadone
Seivewright
68846 Fetal and Neonatal Brain Injury, 4 Ed
Stevenson et al
68869 BLUEPRINTS NEUROLOGY 3E
PB
DRISLANE
69593 NEUROLOGIJA za medicinare
Vesna Brinar i suradnici
69675 Clinical Neurology 7e ISE
Simon
69930 The Human Brain, 6th Edition An Introduction to its Functional Anatomy With
John Nolte
2005 1939.00
2004 9715.00
2002 10795.00
2008 6475.00 2008 22082.00
2007 2008 2007 2008 2008
2745.00 2928.00 6832.00 6100.00 35136.00
2006 1080.00
2006 1944.00
2005 2268.00 2005 10370.00
2006 28060.00 2005 19215.00 2006 7015.00
2006 21350.00 2008 17324.00 2008 17324.00
2008 2008 2009 2007 2007
17324.00 26718.00 5123.00 4320.00 972.00
2008 1080.00
2008 2009 2005 2007 2009
3113.00 16800.00 1512.00 2160.00 7930.00
2009 4270.00
2009 2009 2009 2009 2008
11590.00 3111.00 6860.00 2867.00 5855.00
59 od 116
STUDENT CONSULT Online Access
70092 .OLQLюNDHOHNWURPLRQHXURJUDILMD 70096 Funkcionalna i topografska neuroanatomija 70097 Diferencijalna dijagnoza u neurologiji 70098 Neurokutana oboljenja 70295 .OLQLюNDHOHNWURHQFHIDORJUDILMD 70885 Case Files: Neuroscience 1ed ISE
3HULь=RUDQдDXWRU 0DULQNRYLь6ORERGDQ autor 9UDQMHгHYLь'XгDQDXWRU 9UDQMHгHYLь'XгDQDXWRU 0DUWLQRYLьдDUNRDXWRU TOY
70895 Neurology: PreTest Self-Assessment & Review 7ed ISE
ANSCHEL
71001 Osnovi savremene neurologije 71572 Sleep Disorders Medicine, 3rd Edition Basic Science, Technical Considerations, and Clinical Aspects, Expert Consult - Online and Print
/HYLь=YRQLPLUDXWRU Sudhansu Chokroverty
71596 Clinical Neurotoxicology: Syndromes, Substances, Environments, Expert Consult - Online and Print
Michael R. Dobbs
71610 Clinical Pediatric Neurology, 6th Ed- A Signs and
Gerald Fenichel
Symptoms Approach: Expert Consult - Online and Print
71699 Headache, Orofacial Pain and Bruxism -Diagnosis and Peter Selvaratnam multidisciplinary approaches to management
72401 Decision Making in Neurocritical Care
Frontera, Jennifer A. Frontera
72450 Intracranial Sterotactic Radiosurgery
72451 Neuro-Ophthalmology Illustrated
Valerie Biousse, Biousse, Valrie Biousse
72452 Movement Disorder Surgery: The Essentials
Roy A. E. Bakay
72457 Functional Neurosurgery (Neurosurgical Operative Atlas)
Phillip A. Starr, Nicholas M. Barbaro, Paul S. Lar
72458 Photo Atlas of Skull Base Dissection: Techniques and Masahiko Wanibuchi, Allan
Operative Approaches
H. Friedman, Takanori Fu
72476 Atlas of Brain Function
William W. Orrison
72529 CLINICAL NEUROANATOMY FOR MEDICAL STUDENTS, 7E-IE
SNELL
72620 Oxford Handbook of Neuroscience Nursing, 1 Ed
Woodward, Sue; Waterhouse, Catheryne
73128 ESSENTIAL FORENSIC NEUROPATHOLOGY CB TRONCOSO
73591 MERRITT'S NEUROLOGY 12E
CB
ROWLAND
74197 The Handbook of Clinical Neuropsychology (2/e)
Gurd, Jennifer; Kischka, Udo; Marshall, John
74206 Stroke Medicine
Markus, Hugh; Pereira, Anthony; Cloud, Geoffrey
74227 Migraine and Headache
Mauskopp, Alex
74378 Epilepsy
Alarcon, Gonzalo; Nashef, Lina; Cross, Helen; Nigh
74389 Neurovascular Medicine
Maiese, Kenneth
74391 Deep Brain Stimulation
Bain, Peter; Aziz, Tipu; Liu, Xuguang; Nandi, Dipa
74785 Manual of Neuro-Ophthalmology
Amar Agarwal, Athiya Agarwal
2003 864.00 1998 1620.00
2004 1998 2009 2009
2160.00 1296.00 2484.00 2068.00
2009 1574.00
2009 1307.00 2009 15738.00
2009 14762.00 2009 9393.00 2009 5367.00 2009 5395.00 2009 16195.00 2009 7555.00 2008 14035.00 2008 23755.00 2008 22675.00 2008 7555.00 2009 3294.00 2009 2870.00 2009 14518.00 2009 10614.00 2009 8128.00 2009 5371.00 2009 1749.00 2009 5621.00 2009 10879.00 2009 3120.00 2009 5977.00 60 od 116
76724 Fiziologija centralnog nervnog sistema
0LODQRYLь=YH]GDQ
76960 1HXURORгNLSUHJOHG>SULUXюQLN][email protected]
6WDPHQRYLь-HOHQDDXWRU L]GDYDю
77296 MANUAL NEUROLOGIC THERAPEUTICS 8E PB SAMUELS
77880 Neurology Secrets,5ed
Loren A. Rolak
80315 Kompjuterizovana tomografija centralnog nervnog sistema
6DQMD6WRMDQRYLь
80998 Management of Early Parkinson's Disease
Pahwa, Rajesh; Lyons, Kelly
81000 Parkinson's Disease
Simuni, Tanya; Pahwa, Rajesh
81927 Neuronauke : u susret novom milenijumu
81996 Neuroradiology,3 Ed
David M. Yousem
82082 Pediatric Practice: Neurology
Carney
82697 NEUROLOGY FOR THE NON-NEUROLOGIST 6E PB WEINER
82789 Dijagnoza epilepsija
Krдmer, G.
83057 Movement Disorders in Childhood,
Harvey S. Singer
109944 DISPRAKSIJA
Geoff Brookes
110083 Neurology, 3rd Edition An Illustrated Colour Text
Geraint Fuller
110826 +LWQDVWDQMDXQHXURKLUXUJLMLGLMDJQRVWLюNRWHUDSLMVNL 0LURVODY6DPDUGеLь YRGLю
110856 Harrison's Neurology in Clinical Medicine, Second Edition
Stephen Hauser, Scott Andrew Josephson
110871 Neuromuskularna sinapsa
'UDJLь6ORERGDQDXWRU L]GDYDю
111208 Fundamentals of Computational Neuroscience (2/e) Trappenberg, Thomas
111560 Neuroanatomy,
Alan R. Crossman
111638 Neuromuscular Disorders,
Tulio E. Bertorini
111772 Neurology and Neurosurgery Illustrated, International Lindsay, Bone & Fuller Edition, 5th Edition
112163 POCKET NEUROLOGY
SP
GREER
112430 Deja Review Neuroscience, Second Edition
Matthew Tremblay
112695 *sp* SKRIVENA SNAGA
Ljiljana Trkulja
112717 Spine and Spinal Cord Trauma: Evidence-Based Management
Jerome Ed. Vaccaro
113760 Transient Ischemic Attack and Stroke
Pendlebury/Giles/Rothwell
113761 Modern Surgical Neuropathology with Cd-Rom
Miller
114919 Functional Magnetic Resonance Imaging
Huettel S.
114927 Sensation, Perception and ActionAn Evolutionary Perspective
Zanker J.
115208 TAJNE MOZGA
Amir Muzur
115352 %2/X]URFLLOLMHюHQMH
0-XNLь90DMHULь.RJOHU M. Fingler
115371 NEUROSONOLOGIJA
VIDA DEMARIN I DRUGI
2009 1080.00 2008 378.00
2010 2010 2007
4269.00 4025.00 3564.00
2010 874.00
2010 2000.00
2006 2010 2010 2010 2010 0 2010 2010
702.00 7929.00 7441.00 5978.00 2205.00 7807.00 1680.00 3659.00
2010 1620.00
2010 5245.00
2009 648.00
2009 2010 2010 2010
4370.00 3659.00 14884.00 2195.00
2010 2010 2010 2010
4264.00 1951.00 1008.00 19435.00
2009 2009 2009 2010
4636.00 15860.00 7075.00 3049.00
2010 1820.00 2010 4200.00
5496.00
117423 *ODYREROMHNODVLILNDFLMDLOHюHQMH
0DUWLQRYLьдDUNRDXWRU
118946 IKONOKLAST
G. Berns
119695 Cerebrovaskularne bolesti
6YHWRPLU3,YDQRYLь
nuklearna medicina
10371 *sp* Nuclear Medicine Annual 2003
Leonard, M., Md. Freeman
18937 .OLQLюNDQXNOHDUQDPHGLFLQD
'DUNR,YDQюHYLь
2006 2010 2010
1620.00 2210.00 7560.00
2003 400.00 2240.00 61 od 116
26623 NUKLEARNA KARDIOLOGIJA I PULMOLOGIJA
67HеDN',YDQюHYLь' 'RGLJ,эLNHг
35997 Practical Nuclear Medicine, 3 Ed
P. F. Sharp, H. G. Gemmell, A. D. Murray
43958 Diagnostic Imaging: Nuclear Medicine
Kathryn Morton
48892 Atlas of Cardiac Nuclear Medicine
Jain
50170 Clinical Nuclear Medicine Fourth Edition
Gary J R Cook
68288 Nuklearna medicina : metodologija i klinika
%RJLьHYLь0RPюLORDXWRU
81185 NUKLEARNA MEDICINA XGLMDJQRVWLFLLOLMHюHQMXEROHVWLNRVWLMXL]JORERYD
''RGLJ'+XLь0 Poropat; S. Tezak
oftalmologija
827 *sp* Intraocular Lenses in Cataract & Refractive Surgery
Azar
8169 *sp* Opthalmic Drug Delivery Systems (Drugs and the Ashim K. Mitra Pharmaceutical Sciences, 130)
9739 *sp* Diseases of the Orbit: A Multidisciplinary Approach Jack, Md. Rootman
10438 .OLQLюNDRIWDOPRORJLMDHGLFLMDSUHYRG
Jack J. Kanski
20124 Ophthalmology: Just the Facts
John LoewensteiniScott Lee
20720 *sp* Refractive Eye Surgery
Bores, Leo D.
21718 *sp* Management of Cataracts and Glaucoma
Anne Louise ColemaniJohn Morrison
21741 *sp* Glaucoma Surgery
TROPE
31334 *sp* THE MASSACHUSETTS EYE AND EAR INFIRMARY REVIEW MANUAL FOR OPHTHALMOLOGY 3E
JAGER
35529 Pocket Atlas of Ophthalmology
Torsten Schlote, Jens M. Rohrbach, Matthias Grьb
35537 OPHTHALMOLOGY : A POCKET TEXTBOOK ATLAS Lang, Gerhard Klaus 2 Rev ed
36193 Contact Lenses, 5th edition
Anthony Phillips
43655 Clinical Opthalmology 6th
Kanski
43656 Essentials of Ophthalmology,
Neil J. Friedman
43659 Eye Essentials: Rigid Gas-Permeable Lens Fitting,
Andrew Franklin
43661 Roy and Fraunfelder's Current Ocular Therapy,, 6th Edition
F. Hampton Roy
43943 EVIDENCE BASED EYE CARE
KERTES
45561 Clinical Ophthalmology , 6th edition
Jack Kanski
48036 BASIC OPHTHALMOLOGY FOR MEDICAL
BRADFORD
STUDENTS AND PRIMARY CARE RESIDENTS-8TH
ED
48371 Eyelid, Conjunctival, and Orbital Tumors and Intraocular Tumors: An Atlas and Text 2vol 2e
Jerry A. Shields, Carol L. Shields
48940 *sp* Age-Related Macular Degeneration Second Edition
Lim Jennifer I
52562 Clinical Ocular Pharmacology, 5th edition
Jimmy Bartlett
53255 Pdr 2008 Pdr for Ophthalmic Medicines
Pdr
55084 The Eye: Basic Sciences in Practice
John Forrester
55717 'LMDEHWLюNDUHWLQRSDWLMD
Misita R. Vasilije
55728 Tumori oka
/LWULюLQ2OJD
55731 .OLQLюNDQHXURRIWDOPRORJLMD
6WHIDQRYLь%UDQNR3LгWHOMLь 'XгDQ.UVWLь6WRMDGLQ
59907 Eye Essentials: Cataract: Assessment, Classification Raman Malhotra
2005 2800.00
2005 9066.00
2007 2007 2006 2007 2009
22936.00 14640.00 18605.00 2160.00 1750.00
8241.00 2003 11993.00 2002 8589.00 2004 10700.00 2003 4391.00 2001 6832.00 2004 7533.00 2005 8723.00 2005 3233.00
2006 3775.00
2006 4315.00
2006 2007 2007 2006 2007
18056.00 8334.00 5123.00 2683.00 13786.00
2006 6466.00 2007 20008.00 2004 4318.00
2007 27938.00
2007 18666.00
2007 2008 2007 2000 1998 1997
10979.00 5124.00 10003.00 779.00 779.00 519.00
2007 2683.00 62 od 116
and Management (Eye Essentials) 59911 Rapid Diagnosis in Ophthalmology Series: Retina (Rapid Diagnoses in Ophthalmology) 59912 Rapid Diagnosis in Ophthalmology Series: Lens and Glaucoma (Rapid Diagnoses in Ophthalmology) 59917 Surgical Techniques in Ophthalmology Series: Glaucoma Surgery: Text with DVD (Surgical Techniques in Ophthalmology) 59948 Eye Essentials: Environmental & Occupational Optometry (Eye Essentials) 59971 Ocular Pathology Text with DVD-ROM 60033 Law and Ethics for the Eye Care Professional 61714 Oftalmologija 62129 +LUXUJLMDRюQHGXSOMH 63665 Ophthalmology, 3 Ed -IE 67313 CLINICAL MANUAL OF CONTACT LENSES 3E PB 68058 Oxford Handbook of Ophthalmology (2/e) 68831 Training in Ophthalmology 71666 Ophthalmology, 3rd Edition An Illustrated Colour Text
Adam Rogers, Jay S. Duker Joel S. Schuman, Viki Christopoulos, Deepinder K. Teresa C. Chen Gordon Carson Myron Yanoff, Joseph William Sassani Barbara K. Pierscionek univerzitet u Beogradu medicinski fakulte 5RQюHYLь5DGPLOR3 autor Yanoff BENNETT Denniston, Alastair K. O.; Murray, Philip I. Sundaram, Venki; Barsam, Allon; Alwitry, Amar; Kha Mark Batterbury
2007 6099.00 2007 5611.00 2007 11589.00 2008 2683.00 2008 27572.00 2008 3415.00 2009 1080.00 2003 1164.00 2008 16533.00 2008 6954.00 2009 4120.00 2009 6246.00 2009 3415.00
71785 Crash Course: Ophthalmology, Dermatology, Ent,
Seau-Tak Cheung
72451 Neuro-Ophthalmology Illustrated
Valerie Biousse, Biousse, Valrie Biousse
72464 Ophthalmic Surgical Procedures
Peter S. Hersh, Bruce M. Zagelbaum, Sandra Lora Cr
74214 Diabetes and Ocular Disease (2/e)
Scott, Ingrid U.; Flynn, Harry W.; Smiddy, William
74785 Manual of Neuro-Ophthalmology
Amar Agarwal, Athiya Agarwal
74787 Atlas of Cataract Surgery
K Ravi Kumar Reddy, P. Satyavani
75868 Hirurgija katarakte
%DERYLь6LQLгD
76753 Oculoplasty and Reconstructive Surgery (25 Natural Jes Mortensen, Essam El
Ways Series)
Touhky, Ranjit S. Dhaliwa
76956 Fiziologija oka
$QND6WDQRMHYLь3DRYLь
76957 Uveitisi
$QND6WDQRMHYLь3DRYLь
77290 Surgical Techniques in Ophthalmology Series: Oculoplastic Surgery,
John A. Long
77874 The Massachusetts Eye and Ear Infirmary Illustrated Neil J. Friedman Manual of Ophthalmology ,
80935 6XGVNRPHGLFLQVNRYHгWDюHQMHXRIWDOPRORJLML
-RYDQRYLь0LORгDXWRU
82024 Ocular Inflammatory Disease and Uveitis Manual: Diagnosis and Treatment
HUANG
83056 Uveitis,
Robert B. Nussenblatt
83059 Ocular Disease: Mechanisms and Management,
Leonard a Levin
108892 'LMDJQRVWLNDLSUDьHQMHEROHVWLPDNXOHPHWRGRPRSWLюNH3DRYLь-HOHQDDXWRU koherentne tomografije
109193 Zelena mrena : (glaucom)
3DMLь'XгDQDXWRU L]GDYDю
2009 2927.00 2009 7555.00 2009 12955.00 2009 6878.00 2009 5977.00 2009 11711.00 2009 1836.00 2009 5977.00 2008 2511.00 2008 2997.00 2009 11467.00 2009 6587.00 2007 702.00 2010 6100.00 2010 13664.00 2010 9637.00 2008 3240.00 2007 1728.00 63 od 116
L]GDYDю
109197 2юQRGQRIXQGXVRFXOL
3DMLь'XгDQDXWRU L]GDYDю
109692 Wills Eye Manual, 5e
Ehlers/ Shah
111831 Fundoscopy Made Easy, International Edition
Ghosh, Collier, Varikkara & Palmer
112556 Lens Diseases (Instant Clinical Diagnosis in Ophthalmology)
Gian Maria Cavallini, Arturo Perez Arteaga, Boris
114486 Contact Lens Practice,
Nathan Efron
114490 The Contact Lens Manual,
Andrew Gasson
116739 $QDWRPLMDRNDVDSULORJRP]DDQDWRPLMXL]SRGUXюMD 3DMLь'XгDQDXWRU
neurooftalmologije
L]GDYDю
onkologija
7233 Haematology & Oncology- IE
RCP
7652 *sp* Histopathology of Non-Hodgkin's Lymphomas (Based on the Updated Kiel Classification)
Feller; Diebold
8214 *sp* Carcinogenicity: Testing, Predicting, and Interpreting Chemical Effects
Kirk T. Kitchin
10382 *sp* Radiotherapy for Head and Neck Cancer: Indications and Techniques
Adam S., Md Garden, K. Kian Ang, Gardem Adam S
16485 *sp* Benign Breast Diseases: Radiology-PathologyRisk Assessment
Catherine N. Chinyama
18873 /LMHюHQMHUDNDMDMQLND
Damir Eljuga
18880 ,QWHUQLVWLюNDRQNRORJLMD
=ULQND0UгLь.UPSRWLь
18924 Karcinogeneza
0LOLYRM%RUDQLь
19599 RAK PROSTATE
Mirko Samija
20725 *sp* TUMORS SOFT TISSUES 2ed
DASGUPTA DHURI
21735 Atlas of Gynecologic Oncology
J.Richard Smith,Guiseppe Del Priore,John Curtin,Jo
25208 The Bethesda System for Reporting Cervical Cytology, Solomon, Diane 2 Ed
26609 GINEKOLOSKA ONKOLOGIJA
$QWHыRUXгLь'DPLU%DELь Mirko Samija, Hrvoje So
27336 Laparoscopic Surgical Oncology
Pappas
30626 Oxford Handbook of Oncology, 2 Ed
Jim Cassidy, Donald Bissett, Roy Spence, and Miran
30829 Complementary Oncology Adjunctive Methods in the BeuthiMoss Treatment of Cancer
30836 Practical MR Mammography
Uwe FischeriUlrich Brinck
30950 *sp* Oncology
Alfred E. Chang,Patricia A. Ganz,Daniel F. Hayes
31521 8/75$=98э1,$7/$6'2-.(&'GLIHUHQFLMDOQD eva pichler dijagnoza i interventne tehnike
32098 Melanom
Sanda i Zdenko Stanec
35600 *sp* Radiologic Diagnosis of Gastric Cancer. A New L. M. Portnoy Outlook
35793 *sp* CANCER CHEMOTHERAPY & BIOTHERAPY CHABNER
35905 SURGERY OF THE BREAST 2E 2-VOL
SPEAR
36719 Cancer Biology 3ed
Roger King Mike Robins
37591 ./,1,э.$21.2/2*,-$
Mirko Samija, Eduard Vrdoljak, Zdenko Krajina
37822 UROLOSKA ONKOLOGIJA
5XяHU1RYDN$QWXQ7XFDNL suradnici
2008 3240.00 2010 6094.00 2010 1097.00 2010 5977.00 2010 12078.00 2010 7075.00 2007 2700.00
2003 2440.00 2004 14510.00
1999 900.00
2002 3500.00
2004 4816.00
2003 2004 2002 1998 2005
2100.00 4900.00 2916.00 3500.00 900.00 19520.00
2004 3850.00
2005 6300.00
2006 5245.00 2006 3375.00
2005 8635.00
2003 10692.00 2005 8502.00
2005 3197.00
2006 3500.00 2006 4533.00
2005 2005 2006 2006
6527.00 26230.00 3952.00 2800.00
1994 3500.00
64 od 116
39622 *sp* CANCER PPO REVIEW OF ONCOLOGY
GOVINDAN
43538 *sp* Advances in Nuclear Oncology:
Bombardieri
43950 HANDBK CANCER CHEMOTHERAPY 7E
SKEEL
43977 Clinical Gynecologic Oncology , 7th edition
Philip DiSaia
47517 Harrison's Manual of Oncology
Bruce Chabner, Dan L. Longo
48342 The Washington Manual of Oncology: Department of Ramaswamy Govindan Medicine, Division of Oncology, Washington University School of Medicine, St. Louis, MO (Spiral Manual)
48347 CHEMOTHERAPY SOURCE BOOK 4E
Michael C. Perry
48349 Perez and Brady's Principles and Practice of Radiation HALPERIN Oncology, 5 Ed
48559 TUMORI DOJKE
Mirko Samija, Stjepan -X]EDгLь9LNWRUвHSDURYLьL
48885 Atlas of Operative Laparoscopy and Hysteroscopy
Donnez
48924 Gastrointestinal Oncology Evidence and Analysis
Mcculloch Peter
48942 Image-Guided Radiotherapy of Lung Cancer
Cox James D
50589 BOLESTI DOJKE
-RVLS)DMGLьLVXUDGQLFL
51230 Enzinger and Weiss's Soft Tissue Tumors with CdRom,5 Ed
Sharon Weiss
53847 PSIHOSOCIJALNA ONKOLOGIJA I REHABILITACIJA 0LURVODY3UVWDюLьL5XеD Sabol
2005 2007 2007 2007 2008
1500.00 19673.00 3416.00 14396.00 5489.00
2007 3965.00
2007 6466.00 2007 24278.00
2007 6300.00
2007 2007 2007 1998 2007
21838.00 14030.00 15860.00 4104.00 29890.00
2006 2100.00
55132 Abeloff's Clinical Oncology , 4th Edition -Expert Consult Martin Abeloff - Online and Print
2008 23790.00
55721 Maligne bolesti krvi
0LOLFD'эRORYLь
56218 DeVita, Hellman & Rosenberg's Cancer : Principles and DEVITA Practice of Oncology 8/e (2 VOLUME )
56870 KIRURGIJA DOJKE
MRVLSIDMGLьLYRGеHSLQD
59976 Early Diagnosis and Treatment of Cancer Series: prostate cancer,
Li-Ming Su
59977 Early Diagnosis and Treatment of Cancer Series: Head Wayne Koch and Neck Cancers (Early Diagnosis in Cancer)
59987 Breast Cancer Imaging: A Multidisciplinary, Multimodality Approach
Marie Tartar, Chris E. Comstock, Michael S. Kipper
60143 Cancer Neurology in Clinical Practice: Neurologic Complications of Cancer and Its Treatment (Current Clinical Oncology)
60144 Sensitization of Cancer Cells for Chemo/immuno/Radio -therapy (Cancer Drug Discovery & Development)
60146 Targeted Cancer Therapy (Current Clinical Oncology)
60276 PHARMACOECONOMICS AN INTRODUCTION PB RASCATI
60403 Meyler's Side Effects of Drugs in Cancer and Immunology (Meylers Side Effects)
60859 UNDERSTANDING BREAST CANCER 2E PL1.5 ACC
61721 Lokalizovani karcinom prostate
Jovan Hadzi-Djokic
62003 )LEURFLVWLюQHSURPHQHGRMNHPRUIRORJLMDGLMDJQRVWLND - terapija
62023 Tumor Diagnosis: Practical Approach & Pattern Analysis 2nd Edition
Awatif Al-Nafussi
65676 Practical Clinical Oncology
Hanna/Crosby/Macbeth
1999 1298.00 2008 22936.00
2006 2479.00 2009 10979.00 2008 10979.00 2008 13054.00
2008 15303.00
2008 14169.00
2008 15303.00 2008 3904.00 2008 4879.00
2006 2006
1037.00 2052.00 432.00
2005 29280.00
2008 6100.00 65 od 116
66474 The Washington Manual Hematology and Oncology Subspecialty Consult The Washington Manual Hematology and Oncology Subspecialty Consult, 2 Ed 68850 Pancreatic Cancer 68851 Prostate Cancer 69440 Oxford American Handbook of Oncology 69441 Oxford Handbook of Oncology and Emergencies in Oncology Pack 70600 AJCC Cancer Staging Handbook: From the AJCC Cancer Staging Manual 70672 AJCC Cancer Staging Manual (Edge, AJCC Cancer Staging Manual) 71683 Oncology of Infancy and Childhood,Expert Consult Online and Print
WASHINGTON UNIV Heiken Hricak/Scardino Lyman, Gary H Cassidy, Jim; Bissett, Donald; Spence, Roy; Payne, Stuart H. Orkin
71855 Hughes, Mansel & Webster's Benign Disorders and Diseases of the Breast, 3rd Edition
Robert E. Mansel
71866 2VQRYLNOLQLюNHRQNRORJLMH
6ODяDQD)LOLSRYLь
72459 PET and PET/CT: A clinical guide
Eugene C. Lin, Abass Alavi
73101 Principles and Practice of Gynecologic Oncology, 5 Ed BARAKAT
73102 DEVITA'S CANCER ONCOLOGY REVIEW 2E PB GOVINDAN
73124 BETHESDA HANDBK CLINICAL ONCOLOGY 3E PB ABRAHAM
73150 Wintrobe's Clinical Hematology,2 vol. set
GREER
74226 Surgical Oncology 77128 DERMATOLOSKA ONKOLOGIJA 77447 Karcinom prostate 80991 Antibacterial Chemotherapy 81001 Oxford Handbook of Oncology (3/e) 81027 Oral Complications of Cancer and its Management 81186 PEDIJATRIJSKA ONKOLOGIJA 81293 Breast Cancer 82003 Handbook for Principles and Practice of Gynecologic Oncology 108893 Lek za sve vrste kancera 108894 Lek za sve vrste uznapredovalih kancera 108895 Lek i prevencija za sve vrste kancera (sadrzi i dvd) 109338 Bone Cancer , 109690 Manual of Clinical Oncology, 6e 110396 Rak prostate 110530 /LPIHGHPUXNHSRVOHOHюHQMDUDNDGRMNH 111826 Early Diagnosis and Treatment of Cancer Series: Colorectal Cancer, 112434 Kuerer's Breast Surgical Oncology 112435 Manual of Psycho-Social Oncology
Chaudry, M Asif; Winslet, Marc Christopher -DVQD/LSR]HQюLь$LGD 3DгLьLVXUDGQLFL 0DUNRYLь9HOLERU6DXWRU Amyes, Sebastian Cassidy, Jim; Bissett, Donald; Spence, Roy; Payne, Davies, Andrew; Epstein, Joel Josip Konja Michell LEVINE Klark, Hulda Reger - autor Klark, Hulda Reger - autor Natasa Koderman Dominique Heymann Casciato Mirko Samija i suradnici Goldner, Branislav - autor L]GDYDю Susan Gearhart Henry Kuerer James D. Duffy, Alan Valentine
2008 2867.00
2008 2008 2009 2008
5490.00 5490.00 3752.00 5621.00
2009 3963.00 2009 5664.00 2009 16348.00
2009 10735.00
2009 2009 2009 2009 2009 2008
1944.00 7555.00 18666.00 6466.00 3050.00 24278.00
2009 5621.00
2009 2520.00
2007 2009 2010
1296.00 749.00 4120.00
2010 6246.00
2009 2010 2010
2520.00 6710.00 3166.00
2009 2009 2009 2009 2010 2010 2005
1296.00 1296.00 1620.00 10370.00 3654.00 5648.00 648.00
2010 10979.00
2010 18787.00 2011 6709.00
66 od 116
112436 Herb-Drug Interactions in Oncology
Barrie Cassileth, K.Simon Yeung, Jyothirmai Gubili
112437 Ovarian Cancer: Comprehensive and Contemporary Management
K Chitrathara, Shalini Rajaram, Amita Maheshwari
114571 Leibel and Phillips Textbook of Radiation Oncology, Richard Md Hoppe
114689 CANCER CHEMOTHERAPY & BIOTHERAPY 5E CB CHABNER
115224 Dx/Rx: Pancreatic Cancer
Lowery
115225 Dx/Rx: Gynecologic Cancer
Dizon
115359 32732512,3$/,-$7,912/,-(э(1-( ONKOLOSKIH BOLESNIKA
M. Samija, D. Nemet i suradnici
116009 Nutrition and the Cancer Patient
Del Fabbro, Egidio; Bruera, Eduardo; Demark-Wahnef
116010 Children With Cancer (Rev/Upd ed)
Munn Bracken, Jeanne
116015 Cancer and its Management 6e
Tobias J
117711 Kirurska onkologija
M. Stanec, V. Vrdoljak, M. TuriК
119871 +HPLRWHUDSLMVNLSULUXюQLN
0DUMDQRYLь6ORERGDQ autor
opsta medicina
8544 Checkliste XXL
Hans-Joachim Seidel
9698 Travel Health
Goodyer
9932 *sp* Medical Ethics and Law: The Core Curriculum Hope
10368 *sp* A Practical Approach to Occupational and Environmental Medicine
Robert J. McCunney, Paul P. Rountree, Jeffrey L.
18814 Medicina za pomorce
5RVDQGD0XOLь'DUNR Ropac
18837 Medicinska informatika
XUR'HеHOLь
18876 .URQLюQDERO
9MHQюHVODY.LVHOMDN
18891 Temelji vojnobrodske i podvodne medicine sa zastitom 6WUDьLPLU*RгRYLь disnog sustava
18893 Kako sastaviti,objaviti i ocjeniti znanstveno djelo
9ODWNR6LOREUюLь
18910 Organizacija i upravljanje u zdravstvenoj zastiti
/XND.RODь
19617 35$.7,.80/,-(э(1-$.521,э1(%2/,
Vjenceslav Kiseljak
20549 Strategic Medicines Management
Martin Stephens
24246 *sp* Willard and Spackman's Occupational Therapy 10 CREPEAU Ed
26620 80,-(ы(0(',&,16.(1$67$9(3ULUXюQLN izdanje
дHOLPLUMDNгLь1LNгD Pokrajac, Anton Smalcelj, Ml
26988 *sp* Oxford Handbook of Clinical Specialties, 7 Ed
Collier, Judith
29566 The Merck Manual 18th Edition
Mark H. Beers
30055 Lange Outline Review, USMLE Step 1
Goldberg, Joel S.
30057 Lange Outline Review: USMLE Step 3
Goldberg, Joel S.
30559 Oxford Handbook of Medical Sciences
Cross
30623 Oxford Handbook of Public Health Practice (2/e)
Pencheon, David; Guest, Charles; Melzer, David; Gr
30686 Osnove obiteljske medicine
Robert E.Rakel
31528 MEDICINA IZNUTRA
0DWNR0DUXгLь
31530 359$3202ы'2.75,1$,35$.6$%LEOLRWHND SULUXюQLFL]DRQHNRMLеHOH]QDWLYLгHL]D SROXSURIHVLRQDOQHHNLSHSUYHSRPRьL
Alen Sekelj i suradnici
2010 6343.00 2010 14395.00
2010 2010 2010 2010 2010
22814.00 19154.00 1829.00 1951.00 6160.00
2010 9379.00
2010 2010 2010
2375.00 6094.00 6300.00
2010 1620.00
2002 2003 2003 2003
7555.00 3837.00 400.00 3422.00
2002 2800.00
1997
1512.00 1400.00 2484.00
2003 2002
1750.00 3500.00 1400.00
2005 4484.00 2003 1500.00
2005 3500.00
2006 2006 2006 2006 2006 2006
690.00 5245.00 2927.00 2927.00 2375.00 3495.00
2005 10060.00 2006 1750.00 2006 5600.00
67 od 116
34610 *sp* Oxford Handbook of Clinical Medicine, 7 Ed 34789 Evidence-Based Medicine in Sherlock Holmes' Footsteps 34939 Lange Practice Tests for the USMLE Step 2 ISE 35261 BOARDS & WARDS REVIEW USMLE STEP 36066 BOARD BUSTER STEP 1 36078 REVIEW FOR USMLE STEP 3 2E 36239 Essential Family Medicine, 3rd edition 36856 DEJA REVIEW: USMLE STEP 1 ESSENTIALS-ISE 36859 LANGE Q&A: USMLE STEP 3 -ISE, 3Rev Ed edition 36884 LANGE PRACTISE TESTS FOR THE USMLE 3 36885 LANGE Q&A FOR THE USMLE STEP 2 37816 DIJETE, SKOLA, RODITELJ
Longmore, Murray Nordenstrom GOLDBERG AYALA ZASLAU NMS (ROSNER) Robert Rakel Naheedy, John H. BRISCOE GOLDBERG Zdenka Gruden i Vladimir Gruden
40504 The New Primary Care
Dowling, Bernard
43779 The Test - Saleslogix - The AAMT RMT Review Guide AAMT
43807 Underground Clinical Vignettes STEP 1 BIOCHEMISTRY
SWANSON
43808 Underground Clinical Vignettes STEP 1 MICROBIOLOGY
SWANSON
43809 Underground Clinical Vignettes STEP 1 MICROBIOLOGY
SWANSON
43813 Underground Clinical Vignettes STEP 1 PATHOPHYSIO 5
SWANSON
43814 Underground Clinical Vignettes STEP 1 PHARMACOLOGY
SWANSON
43989 Hutchison's Clinical Methods, 22 Ed - IE
Swash
43991 Medicine & Surgery an Integrated Textbook
Lim
44872 TERORIZAM I MEDICINA Medicinski aspekti bioloskoga, kemijskoga i radioloskoga terorizma
Joshua Shemer i Yehuda Shoenfeld
47784 Current Occupational and Environmental Medicine 4 Ladou, Joseph Rev ed (Lange Medical Books)
48112 MURTAGH'S GENERAL PRACTICE : COMPANION Murtagh, John HANDBOOK Australian ed
48366 Adolescent Health Care: A Practical Guide (Adolescent Lawrence S. Neinstein,
Healthcare: A Practical Guide (Neinstein)) 5e
Catherine Gordon, Debra
Kat
50583 3RYLMHVWPHGLFLQH]DSUDNWLюDUH
Ante Skrobonja,Amir Muzur,Vlasta Rotschild
50585 эXGDPRGHUQHPHGLFLQH
.UHгLPLU3DYHOLь
51161 *sp* Rethinking Informed Consent in Bioethics
Manson/O'neill
52561 Biomedical Ethics
Glannon, Walter
55149 Usmle Step 1 Secrets,
Thomas Brown
55843 Medical Malpractice Survival Handbook
ACLM
56134 Rapid Review USMLE Step 2 (Rapid Review)
Michael W. Lawlor
56819 Textbook Men's Health & Aging
Lunenfeld
57681 Crush Step 3: The Ultimate USMLE Step 3 Review (Secrets)
Adam Brochert
58845 Kontrola infekcije u stomatoloskim ustanovama
9DQMD9XюLьHYLь%RUDV
60030 Managing Clinical Processes
Roslyn Sorensen, Rick Iedema
61047 Oxford Handbook for the Foundation Programme (2/e) Hurley, Nathalie; Dawson,
2007 1500.00 2006 1585.00
2006 2006 2006 2006 2006 2005 2005 2005 2006 2006
2073.00 2434.00 2867.00 2928.00 5245.00 1341.00 1824.00 2195.00 2135.00 2100.00
2003 2006 2007
2439.00 3654.00 1336.00
2007 1336.00
2007 1336.00
2007 1336.00
2007 1336.00
2007 2007 2007
2322.00 6694.00 4200.00
2007 4635.00
2007 3903.00
2007 7198.00
2003 1900.00
2007 2004 0 2007 2006 2007 2008
1900.00 1097.00 1249.00 3171.00 6099.00 3171.00 17690.00 3049.00
2008 840.00 2008 4025.00
2008 2250.00 68 od 116
61123 Making Sense of Medical Ethics: a hands-on guide 62036 Making Sense of your Medical Career: your strategic guide to success 62041 A Textbook of General Practice Second Edition 62047 Public Health Practice and the School-Age Population 62060 Towards Mrcpch Part Ii (Theory) Examination 64904 .$7$/2*',-$*1267,э.,+/$%25$725,-6.,+ PRETRAGA 65455 Family Medicine: Ambulatory Care and Prevention, Fifth Edition: Ambulatory Care and Prevention (Lange Clinical Medicine) 65978 ,VWRULMDPHGLFLQHKURQRORJLMDQDM]QDюDMQLMLKRWNULьDX oblasti medicine, stomatologije i farmacije 66493 Merck Manual of Patient Symptoms, 69224 Oxford Handbook of General Practice (3/e) 69598 POVIJEST KIRURGIJE 69619 ZAUZMITE SE ZA SVOJE ZDRAVLJE 70829 The Common Sympton Guide 6ed ISE
James; Sanders, Stephan; Alan G. Johnson Riaz Agha Dr Anne Stephenson Prof Diane Debell Tapabrata Chatterjee -DGUDQND6HUWLьLVXUDGQLFL Mark B. Mengel, L. Peter Schwiebert 7LPRWLь%UDQLYRMHDXWRU Merck Simon, Chantal; Everitt, Hazel; van Dorp, Francois 9LOMDP%LOLь Donald M. Vickery, James F. Fries WASSON
70830 First Aid A&A for the NBDE Part I 1ed ISE
Steinbacher
70831 First Aid for the ABSITE 1ed ISE
LAFEMINA
70832 First Aid for the Basic Sciences: General Principles LE 1ed ISE 70833 First Aid for the Basic Sciences: Organ Systems 1ed LE ISE
70834 First Aid for the Surgery Clerkship 2ed ISE
KAUFMAN
70835 First Aid for the Wards 4ed ISE
LE
70893 Emergency Medicine: PreTest Self-Assessment & Review 2ed ISE
ROSH
70894 Medicine: PreTest Self-Assessment & Review 12ed ISE
URBAN
70896 Obstetrics & Gynecology: PreTest Self-Assessment & SCHNEIDER Review 12ed ISE
70900 Psychiatry: PreTest Self-Assessment & Review 12ed KLAMEN ISE
70904 First Aid Cases for the USMLE Step 1 2ed ISE
LE
70906 First Aid Q&A for the USMLE Step 1 2ed ISE
LE
71000 Higijena 71648 Step-by-Step Medical Coding 2009 Edition, 71649 Workbook for Step-by-Step Medical Coding 2009 Edition,
.RFLMDQюLь Carol J. Buck Carol J. Buck
2006 2195.00 2005 2195.00
2004 2007 2005 2008
2561.00 2439.00 1829.00 3500.00
2009 4147.00
2008 648.00 2008 1829.00 2009 2625.00 2009 2800.00 2008 1820.00 2009 1707.00 2009 2190.00 2009 2190.00 2009 2800.00 2009 2800.00
2009 1707.00 2009 2927.00 2009 1574.00
2009 1574.00
2009 1951.00
2009 1951.00
2009 1707.00
2009 1829.00
2009 2009 2009
1188.00 5367.00 2317.00
69 od 116
71668 Ferri's Clinical Advisor 2010 5 Books in 1, Expert Consult - Online and Print
Fred Ferri
2009 8295.00
71899 Healthcare Communiction
Bruce Hugman
72527 BLUEPRINTS MEDICINE 5E
PB
YOUNG
73598 REVIEW FOR USMLE STEP 3 3E
PB
NMS (ROSNER)
74361 Textbook of Family Medicine (3/e)
McWhinney, Ian R; Freeman, Thomas
74729 Case Files Family Medicine, Second Edition (Lange Case Files)
Eugene C. Toy, Donald Briscoe, Bal Reddy
74792 Family Medicine PreTest Self-Assessment & Review, Doug Knutson Second Edition (Pretest Clinical Medicine)
75803 2SгWDPHGLFLQDSRURGLюQDPHGLFLQD7RPL

75869 .DUGLRORJLMDXUDGXRSгWHPHGLFLQHSRURGLюQH medicine
0LUMDQD/DSюHYLь'DQH дLJLь6X]DQD 6WDQNRYLь'UDJR
75872 0HWRGRORJLMDQDXюQRJLVWUDеLYDQMDXPHGLFLQVNRMSUDNVL 'DQHдLJLь'UDJROMXE ,YDQNRYLь/MXELQвXNULHY
76722 Zdravstveni menadzment : menadzment zdravstvenog 0LьRYLь3UHGUDJ0DXWRU sistema i zdravstvenih ustanova
80840 8OWUD]YXюQDGLMDJQRVWLNDGLIHUHQFLMDOQDGLMDJQR]D atlas
Guenter Schmidt
81006 Oxford Handbook of General Practice and Emergencies in Primary Care Pack
Simon, Chantal; Everitt, Hazel; Van Dorp, Francois
81241 Usmle Step 2 Secrets,
Theodore X. O'connell
81288 Quality and Risk Management in the Ivf Laboratory Mortimer/Mortimer
81933 Sakupljanje, organizacija i evaluacija informacija
XNLь/-LOMDQD&DXWRU
81934 'REUDSUDNVDXUDGXHWLюNLKRGERUD
6ORERGDQ-DQNRYLь
81936 Komunikacija u biomedicinskim naukama
/MXERPLU7RGRURYLь/MLOMDQD 9XюNRYLь'HNLь
81940 Socijalna medicina : udzbenik za redovnu i postdiplomsku nastavu
RNLь'UDJROMXEDXWRU
109306 Diferencijalna dijagnostika urinarnog nalaza
=YRQLPLU9XNXгLь
110395 /DWLQVNLLKUYDWVNLQD]LYL]DQDMюHгьHEROHVWLLVWDQMDVD -RгNR%XEOLьL1HGD$EHUOH siframa prema MKB 10
111726 Ferri's Clinical Advisor 2011,
Fred F. Ferri
112182 Evidence-based Health Promotion
Perkins ER
112272 Lange Q&A Physician Assistant Examination, Sixth Edition
Anthony A. Miller, Albert F. Simon, Rachel Carlson
112350 CURRENT Diagnosis & Treatment in Family Medicine, Jeannette South-Paul,
Third Edition (Lange Current Series)
Samuel C. Matheny, Evelyn
L.
112357 First Aid for the USMLE Step 2 CK, Seventh Edition: A Tao Le, Vikas Bhushan,
Student to Student Guide (First Aid USMLE)
Herman Singh Bagga
112358 First Aid for the USMLE Step 2 CS, Third Edition (First Tao Le, Vikas Bhushan,
Aid USMLE)
Mae Sheikh-Ali
112361 First Aid Q&A for the NBDE Part II (First Aid Series)
Jason E. Portnof, Timothy Leung
114667 Oxford Textbook of Medicine (5/e)
Warrell, David A.; Cox, Timothy M.; Firth, John D.
114864 Current Essentials of Medicine, 4 Ed- IE
Lawrence M. Tierney
115357 0.)PHяXQDURGQD
M. Strnad, T. Benjak
klasifikacija funkcioniranja, onesposobljenosti i zdravlja
115466 Mйdecine gйnйrale
Pierre-Louis Druais,
2009 2009 2009 2009
3837.00 2562.00 3654.00 3500.00
2009 2805.00
2009 2439.00
2006 7143.00
2005 1333.00
2006 667.00
2008 1296.00
2010 7990.00
2010 5621.00
2010 2008 2009 2009 2008
3171.00 3293.00 1123.00 702.00 1123.00
2007 913.00
2010 378.00 2010 1042.00
2010 1999 2010
7929.00 7319.00 5001.00
2011 3659.00
2009 3903.00 2009 4269.00 2010 4757.00 2010 36890.00 2010 1928.00 2010 2100.00 2009 4995.00 70 od 116
Bernard Gay, Marie-France Le
115467 80 gestes techniques en mйdecine gйnйrale : Guide Bernard Gay des bonnes pratiques
116127 BLUEPRINTS FAMILY MEDICINE 3E PB
LIPSKY
116139 'LMDJQRVWLюNLYRGLь]DHYDOXDFLMXQDMюHгьLKVLPSWRPD John H. Wasson kod odraslih i dece
116375 Detaljan glosar : definicije termina, pojmova i stavovi iz 0LьRYLь3UHGUDJ0DXWRU zdravstvene zastite i menadzmenta zdravstvenog sistema
116445 Komunikacijske vjestine u zdravstvu
/XюDQLQ''HVSRW /XюDQLQ-
117633 General Practice,
Kerryn Phelps
118676 General Practice Companion Handbook, 5 Ed
John Murtagh
ortopedija
14586 Musculoskeletal System: Developmental Disorders, Tumors, Rheumatic Diseases, and Joint Replacement (Netter Collection of Medical Illustrations, Volume 8, Part 2)
Frank H. Netter
14587 Musculoskeletal System: Trauma, Evaluation, and
Frank H. Netter
Management (Netter Collection of Medical Illustrations,
Volume 8, Part 3)
15208 Netter Concise Orthopedics
18849 Ultrazvuk sustava za kretanje
1LNRODэLюDN
18903 Imobilizacija
-DQNR+DQюHYLь
24291 Orthopaedic Clinical Examination An Evidence Based Cleland, Josh Approach
26094 MANUAL OF ORTHOPAEDICS 6E-IE
SWIONTKOWSKI
30078 *sp* Rockwood and Green's Fractures in Adults, 6 Ed BUCHOLZ
31050 *sp* Lovell and Winter's Pediatric Orthopaedics (2 Volume Set)
MORRISSY
31792 *sp* Orthopaedic Biomechanics:Mechanics and Design Donald Bartel in Musculoskeletal
34667 Current Diagnosis and Treatment: Orthopedics, 4 Ed - Skinner ISE
34754 Pocketbook of Orthopaedics and Fractures, 2nd International Edition,
Ronald Mcrae
43987 ADAMS' OUTLINE OF FRACTURES 12E IE
Hamblen
47365 Spinal Deformities. The Essentials
Heary, Albert
47468 CURRENT DIAGNOSIS & TREATMENT IN ORTHOPEDICS ISE
SKINNER
48379 Pediatrics (Master Techniques in Orthopaedic Surgery) Vernon T Tolo
48382 Master Techniques in Orthopaedic Surgery: Relevant MORREY Surgical Exposures
49172 Pocketbook of Orthopaedics and Fractures,
Ronald Mcrae
49748 Campbell's Operative Orthopaedics 4 volumena 11e Canale
50169 Orthopedic Physical Assessment, 5th edition
David Magee
51233 Tachdjian's Pediatric Orthopaedics, 4th edition
John Herring
59932 Delee & Drez's Orthopaedic Sports Medicine: Principles and Practice (Hardcover)
Jesse Delee
59970 Gowned and Gloved Orthopaedics: Introduction to Common Procedures (Gowned and Gloved)
Neil P. Sheth, Jess H. Lonner
60041 Textbook of Orthopaedics, Trauma and Rheumatology: With STUDENT CONSULT Access
2005 6210.00 2010 2989.00 2010 972.00 1123.00 2010 2646.00 2011 9759.00 2011 6587.00 1990 6460.00
1993 6460.00
2003 2001 2005
7929.00 2800.00 1750.00 5855.00
2006 3660.00 2005 15000.00 2005 9089.00
2006 5270.00
2006 2073.00
2006 1341.00
2007 2322.00 2007 10795.00 2007 2073.00
2007 14518.00 2007 15128.00
2006 2007 2007 2007 2008
2927.00 31427.00 7319.00 41724.00 32696.00
2008 3171.00
2008 4391.00
71 od 116
60043 Clinical Tests for the Musculoskeletal System, 2 Ed Buckup
60306 Practical Fracture Treatment 5e IE
McRae
61723 Artroza - stop-program : oboljenje zglobova : osloboditi Fiser, Jirgen - autor VHERODLRVWDWLSRNUHWDQQDMEROMHYHеEHLSUDNWLюQL saveti eksperata
61724 2EROMHQMDNLюPHQRJGLVND
Oldenkot, Paul T. - autor
61958 Bolesti kostiju. [Knj.] 1
9XNDGLQRYLь6WHYDQDXWRU
66276 Essential Orthopaedics and Trauma, International Edition, 5th Edition With STUDENT CONSULT Online Access
Dandy
2008 2008 2006
4315.00 2185.00 702.00
2005 2009
810.00 1080.00 3005.00
68455 Emergencies in Trauma and Orthopaedics 68936 Surgical Exposures in Orthopaedics: The Anatomic Approach, 4 Ed 69408 3RYUHGHLREROMHQMDVWRSDODLVNRюQRJ]JORED 70626 TRAUMATOLOGIJA
Bhangu, Aneel; Lee, Caroline; Porter, Keith HOPPENFELD %XWNRYLь,YDQDXWRU %5$1,0,560,/-$1,ы
2009 2495.00 2009 18666.00 2009 4320.00 2003 2345.00
71194 Arthritis and Arthroplasty: The Hip (Expert Consult Online, Print and DVD)
Thomas E. Brown
71196 Arthritis and Arthroplasty: The Shoulder (Expert Consult - Online, Print and DVD)
David Dines
71273 Adams's Outline of Orthopaedics, 14th Ed -IE
Adams
71397 Adams's Outline of Orthopaedics, 14th Edition
David L. Hamblen
71608 Essential Orthopaedics (Expert Consult - Online and Mark D. Miller Print)
71642 Illustrated Dictionary of Podiatry and Foot Science, 71695 Orthopaedic Physical Therapy, 4th Edition
Jean Mooney Robert Donatelli
71775 Orthopedic Massage: Theory and Technique, 2 Ed Whitney Lowe
2009 18178.00 2009 18056.00 2009 2185.00 2009 4757.00 2009 11467.00 2009 3659.00 2009 8051.00 2009 3903.00
72479 An Illustrated Handbook of Flap-Raising Techniques 73581 ROCKWOOD FRACTURES IN CHILDREN 7E CB 73582 ROCKWOOD FRACTURES IN ADULTS 7E CB 74733 First Aid for the Orthopaedic Boards, Second Edition (First Aid Specialty Boards) 75942 Povrede meniskoligamentarnog aparata kolena
76316 Hirurgija ramena 76931 3RYUHGHHNVWUHPLWHWDOHюHQMHLPHGLFLQVND rehabilitacija 76962 Dijagnoza i terapija reaktivnog artritisa
79857 Oxford Handbook of Orthopaedics and Trauma
80936 Pseudoartroze i defekti kostiju : metod Ilizarova
81195 High Yield Orthopaedics,
82029 HANDBOOK OF FRACTURES 4E
PB
Kartik G. Krishnan BEATY BUCHOLZ Robert A. Malinzak, Mark J. Albritton, Trevor R Pi 1LNROLь'UDJDQDXWRU L]GDYDюLOXVWUDWRUI 'LNOLь,YDQDXWRU 1LNROLьдDUNRDXWRU Ljiljana Pavlica,Milica Prostran Bowden, Gavin; McNally, Martin; Thomas, Simon; Gib 7RPLь6ODYNR0 Javad Parvizi EGOL/KOVAL
2008 2009 2009 2009
8635.00 19032.00 34526.00 5367.00
2006 2160.00
2009 6156.00 2009 2160.00
2008 756.00
2010 4120.00
2001 2010 2010
3780.00 5367.00 4880.00
72 od 116
83023 Netter's Orthopaedic Clinical Examination ,
Joshua Cleland
83028 A Practical Approach to Orthopaedic Medicine,
Elaine Atkins
109322 Clinical Orthopaedic Exam 6e IE
McRae
109897 Hirurski pristupi u ortopediji
Predrag Grubor
110100 Operative Techniques: Orthopaedic Trauma Surgery, Emil Schemitsch
111562 Reconstructive Foot and Ankle Surgery: Management Mark S. Myerson of Complications ,2ed
111600 Aana Advanced Arthroscopy: The Foot and Ankle,
Ned Amendola
111603 Aana Advanced Arthroscopy: The Knee,
Robert E. Hunter
111604 Aana Advanced Arthroscopy: The Hip,
J.W. Thomas Byrd
111626 Fractures of the Proximal Femur: Improving Outcomes, James P. Waddell
111878 Orthopaedics and Rheumatology In Focus,
Ariane L. Herrick
112707 Shoulder Rehabilitation: Non-Operative Treatment
Todd S. Ellenbecker
112716 The Scaphoid
112930 Green's Operative Hand Surgery,
Scott W. Wolfe
112931 Aana Advanced Arthroscopy: The Wrist and Elbow, Felix H. Savoie
114595 Orthopaedic Pathology,
Peter G. Bullough
115039 Neale's Disorders of the Foot Clinical Companion,
Paul Frowen
115424 Surgical Management of Spinal Deformities: Expert Thomas J. Errico Consult: Online and Print (Expert Consult Title: Online + Print)
116130 FAMILY MEDICINE BOARD REVIEW 4E PB
BRATTON
otorinolaringologija
21816 3ULUXюQLNRUDOQLKEROHVWL
99%RUDV$QяD5DLю
31334 *sp* THE MASSACHUSETTS EYE AND EAR INFIRMARY REVIEW MANUAL FOR OPHTHALMOLOGY 3E
JAGER
34626 Oxford Handbook of ENT and Head and Neck Surgery Corbridge, Rogan; Steventon, Nicholas
37962 Otorinolaringologija
дHOMNR%XPEHU9.DWLь B.Pegan
43962 Head & Neck Imaging, 2nd edition
David Yousem
47361 Audiology - Diagnosis
Ross J. Roeser, Michael Valente, Holly Hosford-Dun
48925 *sp* Soft-Tissue Surgery of the Craniofacial Region Persing John
51232 Primary Rhinoplasty with Dvd,
John Tebbetts
56573 Illustrated Lecture Notes in Oral and Maxillofacial Surgery
George Dimitroulis
59968 Oral and Maxillofacial Surgery: 3-Volume Set
Fonseca, Turvey, Marciani
61061 Otolaryngology and Head and Neck Surgery
Warner, Giles; Corbridge, Rogan; Martinez-Devesa,
62057 Oppenheimer's Diagnostic Neuropathology 3rd Edition Margaret Esiri
62067 .OLQLюNLDWODVSRUHPHьDMDJODVDWHRULMDLSUDNVD
0LOXWLQRYLь=RUDQDXWRU
65240 Otorinolaringologija : udzbenik za studente stomatologije
Dergenc, Ranko - autor
65922 .OLQLюNDQHXURRWRORJLMD
Haralampiev, Kiril - autor
71785 Crash Course: Ophthalmology, Dermatology, Ent,
Seau-Tak Cheung
72391 Digital Hearing AIDS
Arthur Schaub
72392 Essentials of Audiology
Stanley A. Gelfand
72467 Ear, Nose, and Throat Diseases: With Head and Neck Hans Behrbohm, Oliver
Surgery, 3 Ed
Kaschke, Nawka, Tadeus
72468 Clinical Voice Disorders [With DVD ROM]
Arnold Elvin Aronson, Diane
2010 2010 2010 2010 2010 2010
5855.00 5611.00 2731.00 3240.00 18056.00 18056.00
2010 2010 2010 2010 2009 2006 2010 0 2010 2009 2010 2008
18056.00 18056.00 18056.00 18910.00 2195.00 4315.00 22927.00 29890.00 18056.00 19764.00 3049.00 19642.00
2010 6222.00 2005 2800.00 2005 3233.00
2006 3120.00
2003 5252.00
2006 4025.00 2007 7555.00
2007 18666.00 2007 30012.00 2008 13176.00
2008 49532.00 2008 5371.00
2006 21350.00 1997 519.00 2007 1080.00
2007 2009 2008 2009 2009
4320.00 2927.00 4315.00 6475.00 5395.00
2009 7555.00 73 od 116
M. Bless
72555 Color Atlas of ENT Diagnosis, 5 Ed
Tony R. Bull, John S. Almeyda
73029 Diagnosis in Otorhinolaryngology: An Illustrated Guide Metin Цnerci
76227 OTORINOLARINGOLOGIJA I KIRURGIJA GLAVE I 9ODGLPLU.DWLь'UDJR
VRATA
Prgomet i suradnici
109699 HANDBOOK CLINICAL AUDIOL 6E (INT ED) CB
KATZ
109949 GLUHI I ZNAKOVNO MEDICINSKO NAZIVLJE - Kako komunicirati s gluhim pacijentom
110874 +URQLюQLULQRVLQX]LWLVGLMDJQR]DLWUHWPDQ
%HOLь%UDQLVODYDXWRU
112039 Otolaryngology
Cummings
patofiziologija
21815 PATOFIZIOLOGIJA za VMS
6WMHSDQ*DPXOLQ$QяD 5DLю
26252 Pathophysiology, 5th Edition
Kathryn L. Mccance
The Biologic Basis for Disease in Adults and Children
2009 4315.00 2009 15870.00 2009 4428.00 2010 7808.00 2010 2229.00 2009 2700.00 2010 28304.00 2005 2800.00 2005 8539.00
43813 Underground Clinical Vignettes STEP 1 PATHOPHYSIO 5 48378 Fundamentals of Molecular Diagnostics 50024 Opsta patoloska fiziologija 50048 :LOPVRYWXPRUQDVWDQDNGLMDJQRVWLNDOHюHQMHL prognoza 50097 PATOLOGIJA 55699 Atlas neuroloske patofiziologije 55705 Patoloska fiziologija-praktikum 56714 Specijalna patoloska fiziologija,drugo izdanje 71347 Pathophysiology, 6th Edition The Biologic Basis for Disease in Adults and Children
SWANSON David Bruns Bogdan Beleslin, Branimir -RYDQRYLь9ODGLPLU1HGH GU6ODYLгDXULюLь Damjanov %UDQLVODYэ3HгLь Bogdan Beleslin Kathryn L. Mccance
2007 1336.00
2007 5245.00 2007 990.00
2007 350.00
2008 2003 2008 2009
11900.00 5108.00 891.00 1790.00 8905.00
72784 Color Atlas of Pathophysiology, 2 Ed
Stefan Silbernagl, Florian Lang
73143 Pathophysiology: An Incredibly Easy! Pocket Guide, 2 LWW Ed
73311 PATHOPHYSIOLOGY OF DISEASE: AN
MCPHEE
INTRODUCTION TO CLINICAL MEDICINE, 6 ED - ISE
2009 3775.00 2009 2434.00 2009 2745.00
76264 Pathophysiology, 4th Edition
Lee-Ellen C. Copstead-Kir
110481 HEART FAILURE 2E
KATZ
110892 ESSENTIALS PATHOPHYSIOLOGY 3E ( INT ) PB PORTH
114055 PATOLOGIJA I PATOFIZIOLOGIJA
Ivan Damjanov, Valerija %ODеLюHYLь
patologija i sudska medicina
4342 Color (Pocket) Atlas of Pathology
Riede
7652 *sp* Histopathology of Non-Hodgkin's Lymphomas (Based on the Updated Kiel Classification)
Feller; Diebold
8250 *sp* Alcoholic Liver Disease: Pathology and Pathogenesis
Pauline Hall, Nancy Coffelt
18887 2SьDSDWRORJLMD
6WDQNR-XNLь
19600 SPECIJALNA PATOLOGIJA
Ivan Damjanov i Stanko -XNLь
19601 $7/$623ы(3$72/2*,-(
Ivan Damjanov i Stanko -XNLь
2009 2008 2010 2010
7807.00 8052.00 4025.00 1526.00
2003 5395.00 2004 14510.00 1995 900.00 2002 4900.00 2004 7000.00 2004 3500.00 74 od 116
-XNLь
19609 SUDSKA MEDICINA I DEONTOLOGIJA
'XгDQ=HюHYLьLVXUDGQLFL
20721 *sp* Russell and Rubinstein's Pathology of Tumours of Bigner the Central Nervous System 6edition, 2 Volume
21319 Osnove patologije
Kumar,Cotran,Robbins
21813 )25(1=,э.$36,+,-$75,-$GUXJRL]GDQMH
'UDJLFD.R]DULь.RYDюLь 0LUMDQD*UXELгLь,OLь$QяD
22073 *sp* Diagnosis of Endometrial Biopsies and Curettings: Kurman, Robert J. A Practical Approach, 2 Ed
22309 Atlas of Head and Neck Pathology, 2nd edition
Wenig
25208 The Bethesda System for Reporting Cervical Cytology, Solomon, Diane 2 Ed
25544 *sp* Principles of Bloodstain Pattern Analysis Theory James Stuart and Practice
26098 Obdukcijska dijagnostika
Mladen Belicza, Davor Tomas
31472 Forensic Neuropathology
Whitwell, Helen
31910 MOLECULAR GENETIC TESTING IN DIAGNOSTIC PFEIFER SURGICAL PATHOLOGY
32798 Diagnostic Histopathology of Tumors, 3rd edition
Christopher Fletcher
34640 Pathology of the Human Placenta, 5 Ed
Kurt Benirschke, Peter Kaufmann, Rebecca N. Baerge
36212 Netter's Illustrated Human Pathology IE
L Buja
36889 Case Files PATHOLOGY
TOY, EUGENE C
43521 Rubin's Pathology: Clinicopathologic Foundations of RUBIN Medicine, 5e
47499 Robbins Basic Pathology, IE, 8th Ed,With Student Consult Online Access
Kumar
48526 Theory and Practice of Histological Techniques, 6th edition
John Bancroft
49954 Trzajna ozljeda, rijesena enigma!,
49963 Essentials of Rubin's Pathology, 5 Ed
RUBIN Emanuel
50143 Robbins i Cotran: Atlas patologije
Edward C. Klatt
51727 Forensic Neuropathology,
Hideo H. Itabashi, Md
56142 Massage Therapist's Guide to Pathology
WERNER
56368 Lymph Nodes
Weiss
56898 Salivary Gland Cytopathology ( Essentials in Cytopathology)
57992 $QDOL]D'1$XVXGVNRMPHGLFLQLLSUDYRVXяX
Dragan Primorac
58571 892'80(',&,16.29-(в7$э(1-(
дLYNR*QMLGLь5DQNR%LOLьL suradnici
59056 Ioachim's Lymph Node Pathology, 4e
IOACHIM
59057 ROSENS BREAST PATHOLOGY 3E
CB
ROSEN
59922 Atlas of Gynecologic Surgical Pathology (Atlas Of...) Philip B. Clement, Robert H. Young
60663 Forensic Science: An Introduction to Scientific and Investigative Techniques, Third Edition
James
61120 Greenfield's Neuropathology Eighth Edition 2-Volume Prof Seth Love Set
62023 Tumor Diagnosis: Practical Approach & Pattern Analysis 2nd Edition
Awatif Al-Nafussi
62034 Russell & Rubinstein's Pathology of Tumors of the Nervous System, 7th Edition
Mclendon et al
62039 Personality Disorder and Serious Offending
Newrith
2004 5600.00 1998 900.00 2000 6370.00 2005 3500.00 2005 4816.00 2006 28792.00 2004 3850.00 2005 6404.00 2005 2100.00 2005 16775.00 2006 10492.00 2007 35014.00 2006 18138.00
2004 2005 2007
3415.00 1806.00 7137.00
2007 3551.00
2007 14640.00
2008 2007 2007 2008 2008 2008
8861.00 3654.00 3490.00 17080.00 3166.00 8540.00 5324.00
2008 2800.00 2008 2800.00
2008 15128.00 2008 24278.00 2008 20496.00
2009 4513.00
2008 35136.00
2005 29280.00
2006 28060.00
2006 12078.00 75 od 116
62039 Personality Disorder and Serious Offending 62051 Adams and Graham's Introduction to Neuropathology, Third Edition 62434 Patologija - prvo Srpsko izdanje 62435 Core pathology IE 62603 Comprehensive Cytopathology, 3 Ed -Expert Consult: Online and Print
Newrith Professor D I Graham Damjanov, Lukic, Nola Alan Stevens Marluce Bibbo
2006 12078.00 2006 7015.00 2008 12600.00 2008 3005.00 2008 29524.00
63018 Sternberg's Diagnostic Surgical Pathology, 5 Ed 65620 Pathology Secrets,3ed 65810 Robinsove osnove patologije 66253 General and Systematic Pathology, International Edition, 5th Edition with STUDENT CONSULT Access
MILLS Ivan Damjanov V. Kumar, A.B. Abbas, N. Fausto, R.N. Mitchell Underwood
2009 34892.00 2009 3171.00 2010 5990.00 2009 3551.00
66274 Robbins & Cotran Pathologic Basis of Disease,With STUDENT CONSULT Online Access, 8 Ed -IE 68814 CT and MRI Pathology: A Pocket Atlas 69023 Gynecologic Pathology, 69095 Understanding Forensic Digital Imaging, 69263 Atlas histopatologija 69435 Robbins and Cotran Pathologic Basis of Disease, Professional Edition, 8 Ed Expert Consult - Online and Print
Kumar
2009 6831.00
Michael L Grey, Jagan Mohan Ailinani Marisa Nucci Herbert L. Blitzer %DVWD-RYDQRYLь*RUGDQD autor Vinay Kumar
2003 1787.00 2009 13542.00 2008 7441.00 2009 4320.00 2009 12566.00
71063 Lange High Yield Pathology Flash Cards, Second Edition (Lange Flashcards) 71085 Robbins and Cotran Pathology Flash Cards, 71200 Robbins and Cotran Review of Pathology,3 Ed 71201 Robbins and Cotran Atlas of Pathology,2 Ed 71309 Wheater's Basic Pathology: A Text, Atlas and Review of Histopathology, International Edition, 5th Edition With STUDENT CONSULT Online Access IE
Suzanne Baron, Christopher Lee Edward C. Klatt Edward C. Klatt Edward C. Klatt Young
2009 3171.00
2009 2009 2009 2010
2927.00 4025.00 4513.00 2731.00
71602 Modern Surgical Pathology,2 Ed, 2-Volume Set, Expert Noel Weidner Consult - Online & Print
2009 37576.00
71871 Rapid Review Pathology,3 Ed
Edward F. Goljan
72532 Diagnostic Surgical Pathology and Molecular Genetics NIKIFOROV of the Thyroid
2009 3659.00 2009 16226.00
72562 Diagnostic Atlas of Melanocytic Pathology Expert Consult: Online and Print
Phillip H. Mckee
2009 17202.00
73015 Dermatopathology: The Basics 73150 Wintrobe's Clinical Hematology,2 vol. set
Bruce R. Smoller, Kim M. Hiatt GREER
2009 5664.00 2008 24278.00
73190 BRS PATHOLOGY 4/E
BRS (SCHNEIDER)
2009 2196.00
73577 BIOPSY INTERP THYROID PARATHYROID CB 73707 Bone Marrow Pathology 4e
BOERNER Bain BJ
2009 12078.00 2009 14639.00
76 od 116
74701 Dermatopathology, Third Edition
Raymond L. Barnhill, A. Neil Crowson, Cynthia M. M
76961 8WYUяLYDQMHVPUWLSUHJOHGXPUOLKVXGVNRPHGLFLQVND 'XQMLь'XгDQ-DXWRU obdukcija
77909 Wheater's Review of Histology & Basic Pathology,
Kate M. Baldwin
81359 Essential Concepts in Molecular Pathology,
William B. Coleman
83024 Scheuer's Liver Biopsy Interpretation,8ed
Jay H. Lefkowitch
109210 Ekspertizna medicina
'XQMLь'XгDQ-DXWRU
109321 Robbins & Cotran Atlas of Pathology 2nd
Klatt
109412 Lippincott's Illustrated Review of Rubin's Pathology 2E FENDERSON
2010 28669.00
2004 702.00
2009 2010 2010 2008 2009 2010
3049.00 5245.00 11590.00 4860.00 3278.00 3776.00
109546 Patologija
-DNLь5D]XPRYLь -DVPLQNDвDUюHYLь Bozena,Sven Seiw
111703 Diagnostic Gynecologic and Obstetric Pathology,2ed Christopher P. Crum
111711 Atlas of Liver Pathology,3ed
Gary C. Kanel
112025 .,585в.$3$72/2*,-$SULMHYRGDPHULюNRJ izdanja)
ROSAI, ACKERMAN
112159 Breast Pathology: Diagnosis by Needle Core Biopsy, ROSEN 3e
113305 Pathology for the Health Professions,
Ivan Damjanov
113391 Thyroid Cytopathology: 8 (Essentials in Cytopathology) Douglas P. Clark, William C. Faquin
113552 Blaustein's Pathology of the Female Genital Tract: 2
113761 Modern Surgical Neuropathology with Cd-Rom
Miller
114055 PATOLOGIJA I PATOFIZIOLOGIJA
Ivan Damjanov, Valerija %ODеLюHYLь
114595 Orthopaedic Pathology,
Peter G. Bullough
114836 Cytopathology
Shambayati, Behdad
116062 Pathology PreTest Self-Assessment and Review
BROWN
2010 3234.00 2010 21960.00 2010 19642.00 2010 40839.00 2010 15982.00 2010 6587.00 2010 7563.00 2010 19272.00 2009 15860.00 2010 1526.00 2009 19764.00 2011 3750.00 2010 1891.00
116137 DIAG PATHOLOGY GENITOURINARY AMIRSYS CB AMIN
116138 BIOPSY INTERPRETATION BLADDER 2E CB
EPSTEIN
117228 BIOPSY INTERPRET OF SOFT TISSUE TUMOR CB FISHER
117229 PATHOLOGY EXAM REVIEW
PB
AHMED
117446 STOCKERS PEDIATRIC PATHOLOGY 3E CB STOCKER / DEHNER
117451 PRACTICAL CARDIOVASCULAR PATHOLOGY CB BURKE
117452 ADVANCE SURGICAL PATH LUNG CANCER CB CAGLE
117802 Dermatopathology,
Nooshin K. Brinster
118794 Atlas of Forensic Histopathology
Cummings/Trelka/Springer
pedijatrija i neonatologija
729 *sp* Caring for Your Premature Baby
Klein
7205 Paediatrics at a Glance -IE
Miall
7247 Maternal Newborn Nursing Care Plans - IE
Green
12415 '0DUGHгLь3HGLMDWULMD
0DUGHгLьLVDUDGQLFL
18877 Pedijatrijska kardiologija,2.dio
,YDQ0DOюLь
18878 Pedijatrijska kardiologija
,YDQ0DOюLь
18925 Od simptoma do dijagnoze u pedijatriji
Vlado Oberiter
20140 *sp* Essential Pediatric Cardiology
Peter Koenig
24350 Essentials of Adolescent Medicine
Donald Greyanus
26068 Nelson Essentials of Pediatrics 5th,IE
Kleigman
2010 2010 2010 2009 2011 2010 2010 2011 2010
26718.00 11468.00 12078.00 12078.00 28060.00 18422.00 10370.00 15738.00 8540.00
1998 2002 2003 2003 2003 2001 1999 2004 2005 2005
400.00 1464.00 1951.00 6059.00 3500.00 2100.00 3500.00 2988.00 3537.00 4781.00
77 od 116
26432 *sp* Pediatric Surgery, 4th edition 26898 Prenatal Diagnosis 27117 Pediatric Neurology, 4th edition 31050 *sp* Lovell and Winter's Pediatric Orthopaedics (2 Volume Set) 31324 Manual of Pediatric Nutrition, 4th edition 31326 Pediatric Cardiology 31344 Oxford Textbook of Palliative Care for Children 36288 Handbook of Neonatal Intensive Care, 6th edition 36470 Oski's Solution: Oski's Pediatrics - Principles and Practice: Plus Intergrated Content Website, 4 Ed 37091 'HюMDJDVWRHQWHURORJLMD 37816 DIJETE, SKOLA, RODITELJ
Ashcraft Evans, Mark I. Kenneth Swaiman MORRISSY Kristy Hendricks Vetter Goldman, Ann Gerald Merenstein MCMILLAN )LOLSRYLь'REULYRMH Zdenka Gruden i Vladimir Gruden
2005 2007 2006 2005
17385.00 10980.00 36234.00 9089.00
2006 2006 2006 2006 2006
4747.00 6221.00 10629.00 5611.00 9760.00
1995 648.00 2006 2100.00
37964 Larousse Enciklopedija za roditelje 43774 Lewis's Child and Adolescent Psychiatry: A Comprehensive Textbook, 4 Ed 43981 PEDIATRIC CLIN EXAM MADE EASY 5E IE
LEWIS Gill
3750.00 2007 13054.00 2007 1092.00
43990 IE Illustrated Textbook of Paediatrics 3E
Lissauer
44005 Nelson Textbook of Pediatrics, 18th edition,IE
Kliegman
47451 Manual of Pediatric Therapeutics (Spiral Manual)
John W. Graef, Joseph I. Wolfsdorf, David S. Green
47518 Lange Q & A: Pediatrics
Jackson, Mary Anne; Viessman, Sara
47621 Practical Paediatrics, 6th edition
Don Roberton
48360 Pediatric Body CT
Marilyn J. Siegel
48366 Adolescent Health Care: A Practical Guide (Adolescent Lawrence S. Neinstein,
Healthcare: A Practical Guide (Neinstein)) 5e
Catherine Gordon, Debra
Kat
48379 Pediatrics (Master Techniques in Orthopaedic Surgery) Vernon T Tolo
49844 *sp* Childhood Obesity Prevention and Treatment Second Edition
Parizkova Jana
49908 2юHPXPRMHGLMHWHUD]PLгOMDVWU
49918 Pedijatrijska gastroenterologija, 632 str.
)HGRUUDLь$QD9RWDYD 5DLь
49957 8PLULWHVYRMHGLMHWHQDSULURGDQQDюLQVWU
51233 Tachdjian's Pediatric Orthopaedics, 4th edition
John Herring
51671 Pediatrics
Bauchner/Vinci/Kim
51804 Nelson Textbook of Pediatrics e-dition, 18th edition Robert Kliegman
55099 The Harriet Lane Handbook 18th ed IE
Johns Hopkins
55101 Forfar and Arneil's Textbook of Pediatrics 7th IE
McIntosh
2007 2007 2007
3005.00 7787.00 3233.00
2009 3171.00
2007 7075.00 2007 13054.00 2007 7198.00
2007 14518.00 2005 2263.00
1849.00 2002 3684.00
2007 2007 2007 2008 2008
1464.00 41724.00 4514.00 19154.00 3141.00 12023.00
55120 Neonatology: Questions and Controversies Series: Neurology 58729 PDR Concise Drug Guide for Pediatrics 59846 Oxford Handbook of Paediatrics 59921 Nutrition in Pediatrics 59949 Feigin and Cherry's Textbook of Pediatric Infectious Diseases: Expert Consult: Online and Print, 2-Volume
Jeffrey Perlman PDR Tasker, Robert C; McClure, Robert J; Acerini, Carl Christopher Duggan, John B. Watkins, W. Allan Walk Ralph D. Feigin, James Cherry, Gail J. Demmler-
2008 6831.00 2008 3659.00 2008 2500.00 2008 12687.00 2008 32696.00 78 od 116
Set (Textbook of Pediatric Infectious Disease (Feigin)) Har
60039 Atlas of Spine Trauma with CD-ROM: Adult & Pediatric Daniel H. Kim, Steven C. Ludwig, Alexander R. Vacc
61067 Paediatric gastroenterology, hepatology and nutrition Beattie, Mark; Dhawan, Anil; Puntis, John WL
61069 Paediatric Respiratory Medicine
Hull, Jeremy; Forton, Julian; Thomson, Anne
61937 /HNDUVNLSULUXюQLNL]GHюMHQHIURORJLMH
3RSRYLь5RORYLь0LODQD autor
61943 8UJHQWQDQHXURORгNDLQHXURPHWDEROLюNDVWDQMDNRG 0DUMDQRYLь%RULYRM'
dece
autor
62014 Brain and Spinal Tumours of Childhood
Walker
62033 Practical Paediatric Problems a Textbook for Mrcpch
Beattie, J
62054 Operative Endoscopy and Endoscopic Surgery in Infants and Children
Najmaldin, a
62060 Towards Mrcpch Part Ii (Theory) Examination
Tapabrata Chatterjee
62130 Akutna limfoblastna leukemija kod dece
.RVWLь*RUGDQDDXWRU
62395 Comprehensive Pediatric Nephrology Text with CD-ROM
Geary & Schaefer
2008 22082.00 2008 4746.00 2008 4370.00 2001 540.00 2006 1960.00 2004 16165.00 2005 5429.00 2005 21838.00 2005 1829.00 2005 432.00 2008 14884.00
63633 Current Pediatric Diagnosis and Treatment IE
Hay
65803 Pediatric Heart Sounds
Michael E. McConnell
66413 Pediatric Endocrinology and Inborn Errors of Metabolism
Kyriakie Sarafoglou, Georg F. Hoffmann, Karl S. Ro
66731 Child and Adolescent Psychiatry
Coghill, David; Bonnar, Sally; Duke, Sandra; Graha
67028 PEDIJATRIJSKA NEUROLOGIJA
1LQD%DULгLьLVXUDGQLFL
68526 Oxford Handbook of Neonatology
Fox, Grenville; Hoque, Nicholas; Watts, Timothy
68559 Principles and Practice of Pediatric Infectious Disease Sarah Long Revised Reprint,
68837 Congenital Malformations: Evidence-Based Evaluation Praveen Kumar, Barbara
and Management
K. Burton
68846 Fetal and Neonatal Brain Injury, 4 Ed
Stevenson et al
68852 Fetal Echocardiography
Allan/Cook/Huggon
68870 BLUEPRINTS PEDIATRICS 5E
PB
MARINO
69024 Paediatric Radiology
Johnson, Karl; Williams, Helen; Foster, Katharine;
70615 HITNA STANJA U DJECE
/-,/-$1$$8'<.2/$5,ы I SURADNICI
2008 2008 2009
3550.00 9066.00 6587.00
2009 4370.00
2009 16800.00 2009 2750.00
2009 20496.00
2007 4879.00
2009 2009 2008 2009
11590.00 11590.00 2684.00 4746.00
2001 2804.00
70887 Neonatology: Management, Procedures, On Call Problems, Diseases and Drugs 6ed ISE
GOMELLA
70899 Pediatrics: PreTest Self-Assessment & Review 12ed YETMAN ISE
71443 Nelson udzbenik pedijatrije. Knj. 1, 17. izdanje 71575 Pulmonary Manifestations of Pediatric Diseases, 71609 The Pediatric Cardiology Handbook, 4 Ed 71610 Clinical Pediatric Neurology, 6th Ed- A Signs and
Nelson L. Turcios Myung K. Park Gerald Fenichel
2009 2763.00 2009 1951.00 2008 7560.00 2009 7807.00 2009 4147.00 2009 9393.00 79 od 116
Symptoms Approach: Expert Consult - Online and Print
71635 Primary Care of the Child With a Chronic Condition, 5th Jackson Allen, Vessey &
Edition
Schapiro
2009 6587.00
71771 Pediatric Manual Medicine: An Osteopathic Approach Jane Carreiro
2009 4757.00
71778 An Osteopathic Approach to Children,2 Ed 71824 Hinman's Atlas Of Pediatric Urologic Surgery, 2nd Edition
Jane Carreiro Frank Hinman
2009 5611.00 2008 25132.00
72354 Oxford Handbook of Children's and Young People's Nursing 72471 Pediatric Imaging: Rapid-fire Questions and Answers 72988 Paediatric Cardiology, 3rd Ed Expert Consult - Online and Print
Glasper Frank L. Quattromani Robert H. Anderson
2006 2375.00 2008 4315.00 2009 24766.00
73314 COLOR ATLAS AND SYNOPSIS OF PEDIATRIC DERMATOLOGY, 2 ED -ISE
KANE
2009 4331.00
73325 Case Files: Pediatrics, 3 Ed -ISE
Toy
2009 1732.00
73561 PRACTICAL GUIDE FETAL ECHOCARDIO 2E PB ABUHAMAD
73588 FETAL MONITORING INTERPRETATION 2E CB CABANISS
74208 Paediatric Haematology and Oncology
Bailey, Simon; Skinner, Roderick
74376 Paediatric Surgery
Davenport, Mark; Pierro, Agostino
74726 Pediatric Emergency Medicine: Third Edition (Strange, Gary R. Strange, William F
Pediatric Emergency Medicine)
Ahrens, Robert W. Schaf
74801 Cases in Pediatric Radiology
Ammar Haouimi
75323 Nadas' Pediatric Cardiology,
John F. (Barry) Keane
76747 Pediatric Practice Endocrinology
Michael S. Kappy, David B. Allen, Mitchell E. Ge
77058 Oxford Handbook of Paediatrics and Emergencies in Tasker, Robert C; McClure,
Paediatrics Pack
Rob; Acerini, Carlo L;
77584 PEDIATRIC SONOGRAPHY 4E
CB
SIEGEL
77916 Fetal Echocardiography,
Julia A. Drose
77954 Pediatric Endocrinology,
Mark A. Sperling
77955 Neurology of the Newborn, 5th Edition
Joseph J. Volpe
2009 10492.00 2009 8052.00 2009 4746.00
2009 5621.00
2009 11590.00
2009 6831.00 2006 10247.00 2009 7319.00
2009 4996.00
2010 2009 2008 2008
17568.00 7807.00 9393.00 12688.00
77956 Hemodynamics and Cardiology: Neonatology
Charles S. Kleinman
Questions and Controversies with Expert Consult Print
and Online,
78009 NAPREDNO ODRZAVANJE ZIVOTA DJECE I 129252(1э$',
Hrvatsko drustvo za reanimatologiju Hrvatskoga lij
80819 Neonatal Emergencies
Hansmann
80823 Neonatal and Infant Emergencies
Sharieff/Mccollough
80833 Pedijatrija i zdravlje deteta
Mary Rudolf, Malcolm Levene
80997 The Ethics of Pediatric Research
Wendler, David
81002 Handbook of Pediatric Physical Diagnosis (2/e)
Barness, Lewis A; GilbertBarness, Enid
81003 Paediatric Dermatology
Lewis-Jones, Sue
2008 6831.00
2007 2100.00
2009 2008
6100.00 6710.00 0.00
2010 3752.00 2010 2814.00
2010 5621.00 80 od 116
81004 Paediatric Intensive Care
Barry, Peter; Morris, Kevin; Ali, Tariq
81020 Emotions in Child Psychotherapy
Barish, Kenneth
81186 PEDIJATRIJSKA ONKOLOGIJA
Josip Konja
81204 Ashcraft's Pediatric Surgery,5 Ed
George W. Holcomb
81207 Manual of Pediatric Anesthesia,
Jerrold Lerman
81218 Merenstein & Gardner's Handbook of Neonatal Intensive Care,
Sandra Lee Gardner
82011 Case Studies in Pediatric Infectious Diseases
Berkowitz
82077 Pediatric Practice: Sports Medicine
Patel
82079 Manual of Neonatal Surgical Intensive Care
Hansen
82081 Pediatric Practice: Infectious Disease
Shah
82082 Pediatric Practice: Neurology
Carney
82110 Essentials of Pediatric Radiology
Daldrup-Link/Gooding
82416 Pediatric Anesthesiology Review: Clinical Cases for Self-Assessment
Robert Holzman, Thomas J. Mancuso, Navil F. Sethna
82417 Handbook of Pediatric Surgery
82430 Nelson Essentials of Pediatrics, International Edition, 6th Edition With STUDENT CONSULT Online Access
Marcdante
82706 VISUAL DIAGNOSIS IN PEDIATRICS 2E CB
CHUNG
83060 Pediatric Ultrasound,
Rose de Bruyn
109691 Manual of Neonatal Care, 6e
Cloherty
109944 DISPRAKSIJA
Geoff Brookes
110086 Nelson Essentials of Pediatrics, 6th Edition With STUDENT CONSULT Online Access
Karen Marcdante
110748 POCKET PEDIATRICS MGH HANDBOOK SP
PRASAD
111549 The Teaching Files: Pediatric,
Sarah Milla
111714 Fanaroff and Martin's Neonatal-Perinatal Medicine, 9th Richard J. Martin Edition, Diseases of the Fetus and Infant (Expert Consult - Online and Print) (2-Volume Set)
111819 Neonatal Nutrition and Metabolism
Thureen/Hay
111836 Assisted Ventilation of the Neonate,
Jay P. Goldsmith
111838 Pediatric Secrets,5ed
Richard A. Polin
111839 Pediatric Allergy,2ed
Donald Y. M. Leung
112546 CURRENT Diagnosis and Treatment Pediatrics, Twentieth Edition (Lange Current Series)
William W. Hay, Myron J. Levin, Robin R Deterding
112743 Pediatric Imaging (RadCases)
Richard Gunderman, Lisa Delaney
113528 Nutritional Strategies for the Very Low Birthweight Infant
Adamkin
113529 Case Studies in Pediatric Critical Care
Murphy/Marriage/Davis
113530 Neonatology
Polin/Lorenz
113532 Ethical Dilemmas in Pediatrics
Frankel et al
113533 Neonatal Cerebral Investigation
Rennie/Hagmann/Robertso n
113535 Practical Neonatal Endocrinology
Ogilvy-Stuart/Midgley
113536 Neonatal Hematology
de Alarcon/Werner/Naiman
113537 Pediatric and Adolescent Psychopharmacology
Greydanus/Calles, Jr/Pate
113539 Neurodevelopmental Outcomes of Preterm Birth
Nosarti/Murray/Hack
113865 PEDIATRIC FACTS MADE INCRED QUICK 2E SP SPRINGHOUSE
114024 Pediatric Cardiology 2e
Johnson W
2010 5621.00
2010 2009 2010 2010 2010
2500.00 2520.00 23546.00 5855.00 5611.00
2007 2009 2009 2009 2010 2010 2010
4514.00 6221.00 5245.00 6221.00 7441.00 7930.00 8961.00
2010 6399.00 2010 4269.00
2010 2010 2010 2010 2010
10614.00 5489.00 3654.00 1680.00 5733.00
2009 4026.00 2010 10247.00 2010 22082.00
2006 2010 2010 2010 2010
21594.00 7563.00 3171.00 9881.00 6953.00
2010 4482.00
2009 3293.00
2009 2008 2009 2008
4636.00 4392.00 2805.00 13908.00
2006 5002.00 2005 14640.00 2008 4392.00
2010 2010 2008
7320.00 1946.00 5611.00
81 od 116
114336 TEXT PEDIATRIC EMERGENCY MEDICINE 6E CB FLEISHER
114447 Neofax 2010 23e
PDR
114840 Handbook of Paediatrics 7e (7/e)
Motala, Cassim; Fugaji, Anthony; Davidson, Alan; L
114842 Paediatric Palliative Medicine
Hain, Richard D. W.; Jassal, Satbir Singh
115209 PSIHOTERAPIJSKA PEDAGOGIJA
Zdenka Gruden
115478 Urgences pйdiatriques
Antoine Bourrillon, Gйrard Chйron
115481 Pйdiatrie
collectif, Antoine Bourrillon, Grйgoire Benoist
116010 Children With Cancer (Rev/Upd ed)
Munn Bracken, Jeanne
116057 .OLQLюNDSXOPRORJLMDXSHGLMDWULML
1LNROLь3DVNDODXWRU
116281 Neonatology at a Glance 2e
Lissauer T
117446 STOCKERS PEDIATRIC PATHOLOGY 3E CB STOCKER / DEHNER
118476 Odabrana poglavlja iz pedijatrijske dermatologije
Situm, M., (ur.)
118910 Examination Paediatrics,
Wayne Harris
SODVWLюQDKLUXUJLMD
24290 *sp* Psychological Aspects of Reconstructive and Cosmetic Plastic Surgery: Clinical, Empirical and Ethical Perspectives
SARWER
37819 35$.7,э1$3/$67,э1$.,585*,-$
Neven Olivari
48890 Textbook of Liposuction
Hanke
48925 *sp* Soft-Tissue Surgery of the Craniofacial Region Persing John
59956 Plastic Surgery: Indications and Practice: Expert Consult Premium Edition: Enhanced Online Features, Print, and DVD, 2-Volume Set (Expert Consult 2 Vol Set & DVD)
Bahman Guyuron, Elof Eriksson, John A. Persing
61062 Plastic and Reconstructive Surgery
Giele, Henk; Cassell, Oliver
62021 Facial Plastic Surgery
Vuyk, H.D.
63655 General Reconstructive Surgery with Dvd,
Gregory Evans
63657 Atlas of Abdominoplasty with Dvd,
Joseph Hunstad
63659 Atlas of Cosmetic Surgery with Dvd,
Michael Kaminer
63661 Cosmetic and Reconstructive Breast Surgery with Dvd, Maurice Nahabedian
71202 Oncoplastic Surgery of the Breast with Dvd,
Maurice Nahabedian
71787 Techniques in Aesthetic Plastic Surgery Series: Facial Steven Cohen Rejuvenation with Fillers with Dvd,
71788 Techniques in Aesthetic Plastic Surgery Series: Aesthetic Breast Surgery with Dvd,
Louis Bucky
72395 Plastic and Reconstrutive Surgery of the Breast: A Surgical Atlas
Christian J. Gabka, Heinz Bohmert, Philip Blondeel
72447 Facial Plastic and Reconstructive Surgery
Ira D. Papel
72479 An Illustrated Handbook of Flap-Raising Techniques Kartik G. Krishnan
72568 7DMQHHVWHWVNHKLUXUJLMHюLQMHQLFHLIDVFLQDFLMH PRJXьQRVWLLJUDQLFH
Panfilov, Dimitrije E. - autor
posteri
14592 Male Reproductive System, Poster
15428 Anatomy of the Ear Chart, Poster
Frank H. Netter
18036 Gastrointestinal System
59060 Dangers of Alcohol Anatomical Chart, 2e - Paper
ACC
59061 Dangers of Alcohol Anatomical Chart, 2e - Laminated ACC
60857 THE BRAIN Poster
ACC 9920PU
2010 17568.00 2010 2927.00 2010 5002.00
2010 4370.00
2010 1890.00 2005 5940.00
2009 5265.00
2010 1997 2011 2011 2010 2011
2375.00 260.00 3171.00 28060.00 2205.00 5855.00
2005 4880.00
2006 2007 2007 2008
19600.00 15860.00 18666.00 49044.00
2008 2006 2008 2008 2008 2008 2009 2009
5371.00 21045.00 11955.00 11833.00 18544.00 11955.00 11955.00 13298.00
2009 13298.00
2008 19435.00
2008 22675.00 2008 8635.00 2700.00
2003 2008
1458.00 1458.00 1458.00 482.00
2008 1037.00 2001 482.00
82 od 116
61447 DIGESTIVE SYSTEM
PU
psihijatrija
18840 Zakon o zastiti osoba s dusevnim smetnjama
18931 Govor snova
18934 Grupna analiza
18936 Psihoanaliza zalovanja
19604 SNOVI U PSIHOTERAPIJI
19605 FORENSIC PSYCHIATRY, PSYCHOANALYSIS AND CRIMINAL LAW
21813 )25(1=,э.$36,+,-$75,-$GUXJRL]GDQMH
26619 NUSPOJAVE PSIHOFARMAKA 30640 *sp* Rapid Review Behavioral Science 37593 PRIMIJENJENA PSIHOTERAPIJA
37594 Psihijatrija 37937 Journey into the Heart of Bipolarity 41818 GRUPNA PSIHOTERAPIJA za medicinske sestre i WHKQLюDUH 43774 Lewis's Child and Adolescent Psychiatry: A Comprehensive Textbook, 4 Ed 43791 Kaplan and Sadock's Study Guide and SelfExamination Review in Psychiatry 43795 NMS: PSYCHIATRY 5/E
ACC 9859PU Miroslav Goreta %UDQND-DNHOMLь Eduard Klajn Ivan Buzov Ivan Buzov Miroslav Goreta 'UDJLFD.R]DULь.RYDюLь 0LUMDQD*UXELгLь,OLь$QяD Uzun, Kozumplik, Mimica Stevens Vladimir Gruden, ml., Zdenka Gruden, Vladimir Grud Ljubomir Hotujac i suradnici Philippe Nuss with Marie Sellier and Jean-Paul Bat Eduard Klain, Rudolf Gregurek i suradnici LEWIS Benjamin J Sadock, Virginia A Sadock, Ze'ev Levin NMS (THORNHILL)
2001 482.00
2000 2002 2008 1993 2004
2240.00 2100.00 1680.00 546.00 840.00 2800.00
2005 3500.00
2005 2003 2006
1750.00 1250.00 3500.00
2006 1750.00 2005 5832.00 2007 1750.00 2007 13054.00 2007 3904.00 2007 2928.00
47279 Stahl's Essential Psychopharmacology 47507 PSYCHIATRY : AN OXFORD CORE TEXT 3 Rev ed (Oxford Core Texts) 48560 36,+,э.(326/-(',&(75$80( 54185 CONCISE TEXTBK CLINICAL PSYCHIATRY 3E PB 56123 Depression and Bipolar Disorder 56133 Rapid Review Behavioral Science (Rapid Review) (Rapid Review) 56321 Antipsychotics and Mood Stabilizers 58572 PSIHOTERAPIJSKA SUPERVIZIJA 59985 Psychiatry (Crash Course - UK) 61053 Emergencies in Psychiatry 61135 Overcoming Postnatal Depression: a Five Areas Approach 62013 Maintaining Control: An Introduction to the Effective Management of Violence and Aggression 62017 Mrcpsych Part I: Passing the Osce 62024 The Complete Mrcpsych Part I: a Comprehensive Guide to the examination 62028 The Complete Mrcpsych Part Ii: a Comprehensive Guide to the examination 62029 Culture and Mental Health: a comprehensive textbook 62039 Personality Disorder and Serious Offending
Stahl/Muntner Geddes, John; Gelder, Michael G.; Mayou, Richard 0ODGHQ/RQюDU1HYHQ Henigsberg i suradnici SADOCK Stahl Vivian M. Stevens, Susan K. Redwood, Jackie L. Nee Stahl Maria C. Gilbert, Kenneth Evans Julius Bourke, Matthew Castle Puri, Basant; Treasaden, Ian Dr. Christopher Williams John Edward Gillett Dr Justin Sauer Ashok Patel Ashok Patel Kamaldeep Bhui Newrith
2008 3660.00 2005 2750.00
2007 2100.00
2008 2008 2007
4874.00 3050.00 3171.00
2008 3050.00 2008 2100.00
2008 2927.00
2008 2745.00
2008 2805.00
2003 2805.00
2005 2683.00 2006 2683.00
2006 3293.00
2007 12078.00 2006 12078.00 83 od 116
62039 Personality Disorder and Serious Offending
Newrith
62042 Dementia 3rd Edition
Alistair Burns
62059 MRCPsych: Part 1 - 2: Individual Statements and EMI Justin Sauer Practice Exams
62747 *5831$$1$/,=$DQDOLWLюNDJUXSQDSVLKRWHUDSLMD Eduard Klain i suradnici izdanje
65811 Psihijatrija
Michael Gelder
65923 8YRGXNOLQLюNXSVLKRSDWRORJLMXRGVLPSWRPDGR dijagnoze u psihijatriji)
Munjiza, Marko - autor
65928 Delirijum i akutno konfuzno stanje u psihijatriji, neurologiji i somatskoj medicini
Munjiza, Marko - autor
65930 $NXWQHLKURQLюQHSVLKR]HXSULPDUQRM]GUDYVWYHQRM zastiti
Munjiza, Marko - autor
65931 3UYLLQWHUYMXXNOLQLюNRMSUDNVL
Munjiza, Marko - autor
65934 Neuroloski simptomi i sindromi u psihijatriji
9HOLюNRYLь$OHNVDQGDU autor
66731 Child and Adolescent Psychiatry
Coghill, David; Bonnar, Sally; Duke, Sandra; Graha
66917 Psihofarmakoterapija
,YDQD7LPRWLMHYLь
66918 /LWLMXPLDIHNWLYQLSRUHPHьDML
7LPRWLMHYLь,YDQDDXWRU
67751 3VLKRDQDOLWLюNDSVLKRWHUDSLMDGHFHLPODGLK
7DGLь1HYHQNDDXWRU
67753 Psihijatrija detinjstva i mladosti
7DGLь1HYHQNDDXWRU
67754 2VHьDMQRLVD]QDMQR
7DGLь1HYHQNDDXWRU
67761 Budite sebi psihoterapeut
Rejnvoter, DZenet - autor
67762 ,VWRюQMDюNHSULюHXSVLKRWHUDSLML
Peseskijan, Nosrat - autor
68059 Oxford Handbook of Psychiatry (2/e)- IE
Semple, David; Smyth, Roger
68249 .OLQLюNDSVLKLMDWULMD
0DULь-RYDQDXWRU L]GDYDю
68295 Bez straha o strahu, panici i fobiji
6WDUюHYLь9ODGDQDXWRU
68296 3DQLюQLSRUHPHьDMIDUPDNRWHUDSLMD NRJQLWLYQR bihejvioralna terapija
%DWLQLь%RUMDQNDDXWRU
68297 3VLKLMDWULMDXNULWLюNRPRJOHGDOX
.HFPDQRYLь'XгDQDXWRU
68567 Kaplan and Sadock's Comprehensive Textbook of Psychiatry (2 Volume Set, 9 Ed
SADOCK
68747 Fuga za bajamama od Dinare do Avale : (autobiografija Munjiza, Marko - autor o spoznaji sebe i duse psihijatrije)
68812 Psychiatry Board Review: Pearls of Wisdom, Third Edition (Pearls of Wisdom Medicine)
Rebecca A. Schmidt
68822 Old Age Psychiatry
Sheehan, Bart; Karim, Salman; Burns, Alistair
68825 Philosophy, Psychoanalysis and the A-rational Mind Brakel, Linda A W
68826 Psychiatry PRN: Principles, Reality, Next Steps
Stringer, Sarah; Church, Laurence; Davison, Susan;
68827 Oxford Textbook of Suicidology and Suicide Prevention Wasserman, Danuta; Wasserman, Camilla
68838 The Prescriber's Guide, 3 Ed
Stahl
68839 The Prescriber's Guide, Antipsychotics and Mood Stabilizers
Stahl
68840 The Prescriber's Guide, Antidepressants
Stahl
68841 Antidepressants
Stahl
68842 Stahl's Illustrated Antipsychotics
Stahl
68843 Stahl's Illustrated Mood Stabilizers
Stahl
68844 Community Treatment of Drug Misuse: More Than
Seivewright
2006 12078.00 2005 19215.00 2005 2683.00
2008 4200.00
2009 1490.00 2008 2268.00
2006 540.00
2005 540.00
2007 2007
756.00 972.00
2009 4370.00
2008 2007 2004 2006 2007 2003 2008 2009
1188.00 972.00 1620.00 1080.00 540.00 432.00 432.00 3495.00
2005 810.00
2008 2009
756.00 648.00
2008 972.00 2009 24278.00
2008 756.00
2009 5855.00
2009 4370.00
2009 3745.00 2009 2250.00
2009 9379.00
2009 5246.00 2009 2683.00
2009 2805.00 2009 3049.00
2009 2009 2009
3049.00 3049.00 4270.00
84 od 116
Methadone 68854 Bipolar Disorder in Young People 68866 Kaplan and Sadock's Concise Textbook of Child and Adolescent Psychiatry 69310 Current Diagnosis and Treatment Psychiatry ISE 69618 Psihosomatska medicina i konsultativna psihijatrija : SULUXюQLN]DNOLQLюNXSUDNVX 69620 3VLKRGLQDPLюNDSVLKLMDWULMD7RP7HRULMHVWUDKDL stanja straha 69621 3VLKRGLQDPLюNDSVLKLMDWULMD7RP,VWRULMDRVQRYQL principi, teorije 69631 Stres : zdravlje - bolest 70104 Emocije : psihoterapija i razumevanje emocija 70105 Formule ljubavi : kako ne upropastiti sopstveni zivot WUDеHьLSUDYXOMXEDY 70685 ZLOUPORABA DROGA I OVISNOST O DROGAMA,BIBLIOGRAF.RADOVA
Macneil et al SADOCK
2009 2008
Ebert $GDPRYLь9ODGLPLUDXWRU
2008 2005
/-XERPLU(ULь
2009
/-XERPLU(ULь
2008
3UHGUDJ.DOLюDQLQ6YHWRPLU 6WRеLQLь1LNRODM3DOH =RUDQ0LOLYRMHYLь 0LOLYRMHYLь=RUDQDXWRU
2001 2008 2009
0$-672529,ы0,вэ,1
2001
3659.00 4874.00 3038.00 1350.00 1566.00 1512.00 1080.00 2268.00 1296.00 836.00
70900 Psychiatry: PreTest Self-Assessment & Review 12ed KLAMEN ISE
70924 Bolesti zavisnosti : pusenje, alkoholizam i narkomanija : 1LNROLь'UDJRVODYDXWRU knjiga za svaku porodicu
70925 Akcioni program primarne prevencije bolesti zavisnosti 'UDJRVODY1LNROLь pusenja, alkoholizma i narkomanije : knjiga za svaku porodicu
71818 Mental Health: From Policy to Practice
Charles Brooker
71819 Mental Health Nursing, 2 Ed
Rob Newell
71828 Psychiatric Drugs Explained, 5th Edition
David Healy
72618 Oxford Handbook of Learning and Intellectual Disability Gates, Bob; Barr, Owen Nursing, 1 Ed 73203 Lippincott's Manual of Psychiatric Nursing Care Plans SCHULTZ 8/e
73327 Case Files: Psychiatry, 3 Ed -ISE
Toy
74215 Attention-Deficit Hyperactivity Disorder and Hyperkinetic Disorder 74997 Overcoming Anxiety, Stress and Panic a Five Areas Approach Second Edition 76212 Ono i mi 77130 PSIHIJATRIJA 80462 social cognition and Developmental Psychopathology 80826 Stahl's Illustrated Chronic Pain and Fibromyalgia 80830 Stahl's Illustrated Attention Deficit Hyperactivity Disorder 81019 Depression in Later Life 81020 Emotions in Child Psychotherapy
Banaschewski, Tobias; Coghill, David; Danckaerts, Dr Chris Williams 6YLюHYLь5DGRVODYDXWRU 7)UDQюLгNRYLь/M0RURL suradnici Sharp, Carla; Fonagy, Peter; Goodyer, Ian Stahl/Muntner/Ball Stahl/Mignon Baldwin, Robert Barish, Kenneth
2009 1951.00
2007 2007
648.00 324.00
2008 3659.00 2008 3171.00 2008 2561.00 2009 2495.00 2008 3294.00
2009 1732.00 2009 749.00 2009 2805.00
816.00 2009 3780.00 2008 4746.00 2009 3049.00 2009 3049.00 2010 749.00 2010 2500.00 85 od 116
81020 Emotions in Child Psychotherapy
Barish, Kenneth
81021 Severe Depression
McIntyre, Roger; Nathanson, Jay
81187 SIMBOLI PROMJENE analiza predigre jedne shizofrenije
Carl Gustav Jung Marijan Cipra
81189 6895(0(1$36,+2$1$/,7,э.$36,+27(5$3,-$ 0LUNRэRUOXNLь relacijska sinteza
81994 3ULUXюQLN]DSUHYD]LODеHQMHDQNVLR]QRVWLLIRELMD
Born, Edmund - autor
82099 HANDBOOK OF PSYCHIATRIC DRUGS 6E PB ROSENBAUM
82703 Kaplan and Sadock's Pocket Handbook of Clinical Psychiatry, 5 Ed
SADOCK
109192 Tajni prsten : Frojdov uzi krug saradnika i politika psihoanalize
Groskurt, Filis - autor
109194 Kompletan uvod u psihoanalizu
Frojd, Sigmund - autor
109681 Kaplan and Sadock's Synopsis of Psychiatry, 10e
Sadock
110397 Tretman seksualnih delikvenata i zastita zajednice
/DQD0XеLQLь/MLOMDQD Vukota
112545 Destruktivnost i autodestruktivnost mladih
9RMLVODYыXUюLь
113762 Personal Recovery and Mental Illness
Slade
113940 Managing Social Anxiety,Therapist Guide, 2nd Edition Hope, Debra A.; Heimberg,
()
Richard G.; Turk, Cynthi
115386 ,QVWUXPHQWLNOLQLюNHSURFHQHXSVLKLMDWULML
7LPRWLMHYLь,YDQDDXWRU
115866 Single Case Experimental Designs:Strategies for Studyin 3ed
David Barlow Matthew Nock Michael Hersen
116309 6WUHVSURFMHQDLVXRюDYDQMH
Lazarus, Richard S. , Folkman, Susan
117232 Designing and Conducting Mixed Methods Research Creswell,John W;Clark,Vicki L Plano
118463 $QNVLR]QLSRUHPHьDML
Hollander, E., D. Simeon
118468 3DQLюQLSRUHPHьDMLLDJRUDIRELMDWHUDSLMVNLYRGLю
Latas, Milan - autor
118475 Neuropsihologijska procjena, Testovi i tehnike, 2. izdanje
*DOLь6ODYND
118796 Antipsychotics and their Side Effects
Gardner/Teehan/Baldessari
119691 7XPDюHQMHQHXUR]DOHюHQMHLVDPRSRPRь
=GUDYNRYLь-H]GLPLUDXWRU
psihologija
4215 The Heart of Listening, Vol. 1
MILNE
9232 *sp* Biographical Dictionary of Psychology
Sheehy; Chapman
18841 Osnove obiteljske terapije
6WDQLгD1LNROLь
18844 Samoubojstvo mladih
,YLFD6WDQLь
18848 3RVWWUDXPDWVNLVWUHVQLSRUHPHьDM
Rudolf Gregurek
18928 Psihoterapijska pedagogija
Zdenka Gruden
18946 Susret kao Lijek
Milan Kosuta
20931 Psihologija u menadzmentu
Abraham Maslov
21561 RAZUMIJEVANJE EMOCIJA
Keith Oatley, Jennifer Jenkins
21731 Transformative Relationships: The Control-Mastery Theory of Psychotherapy
George Silberschatz
23231 Medicinska psihologija sa osnovama psihopatologije 'HVLPLURYLь
24403 Research Methods in Psychology
Shaughnessy, John J.
24456 Psychology Updated with In-Psych Plus Student CD- Santrock ROM and PowerWeb
25849 *sp* Ise: Research Methods in Psychology 8e
Elmes
26286 SOCIJALNA PSIHOLOGIJA
Elliot Aronson, Timothy D.
2010 2500.00 2010 749.00
2009 4900.00
2009 2800.00
2008 2009 2010
1620.00 3660.00 4575.00
2009 1296.00
2006 2010 2010
1944.00 4880.00 3270.00
2010 2009 2010
864.00 4270.00 3439.00
2010 810.00 2008 5489.00
2004 4704.00
2010 3537.00
2006 2010 2009
2646.00 756.00 4704.00
2010 4270.00 2010 648.00
2002 1996 1999 2000 1994 2004 2007
3559.00 1220.00 1680.00 1400.00 2100.00 1680.00 1120.00 1836.00 4116.00
2005 2683.00
1997 2005 2004
648.00 3781.00 3960.00
2005 3953.00 2005 5010.00 86 od 116
Wilson, Robin Akert,
28161 Motivacija
Rheinberg Falko
31232 Methods in Behavioral Research: WITH Powerweb Paul C. Cozby
34842 Life Would Be Easy If It Weren't for Other People
Connie Podesta, Vicki Sanderson
36736 Human Development: WITH PowerWeb
Corinne Haines Crandell, James Wilfrid Vander Zand
40684 Theories of Infant Development
Bremner
41819 LJUBAV NA DRUGI POGLED Proslost i sadasnjost VSHFLILюQROMXGVNRJRVMHьDMD
43774 Lewis's Child and Adolescent Psychiatry: A Comprehensive Textbook, 4 Ed
LEWIS
45292 I Just Lost Myself: Psychological Abuse of Women in Valerie Nash Chang Marriage
45307 Women Growing Older
Turner,Barbara F;Troll,Lillian E
45922 How the Special Needs Brain Learns
Sousa,David A
51012 The Autism Spectrum and Further Education: A Guide Breakey, Christine to Good Practice
53692 *sp* Handbook of Psychology: Forensic Psychology v. Weiner IB 11
56321 Antipsychotics and Mood Stabilizers
Stahl
58548 Helping Pupils with Autistic Spectrum Disorders to Learn
Pittman,Mary
60490 Global Conflict Resolution Through Positioning Analysis (Peace Psychology Book Series) (Peace Psychology Book Series)
60733 Willard and Spackman's Occupational Therapy, 11 Ed CREPEAU
61172 Biological Psychology
Rosenzweig M. et al
62017 Mrcpsych Part I: Passing the Osce
Dr Justin Sauer
62029 Culture and Mental Health: a comprehensive textbook Kamaldeep Bhui
64039 Health Behavior and Health Education: Theory, Research and Practice, 4 Ed
Glanz K
64489 Working with Emotional Intelligence
Daniel Goleman
65237 3VLKRORгNLUHюQLN
.UVWLь'UDJDQDXWRU
65660 Sensation and Perception
Wolfe et al J.
66731 Child and Adolescent Psychiatry
Coghill, David; Bonnar, Sally; Duke, Sandra; Graha
67571 Introduction to Neuropsychopharmacology
UNKNOWN
67756 2SгWDSVLKRORJLMDVDSVLKRORJLMRPOLюQRVWLXYRGQD predavanja
Hrnjica, Sulejman - autor
68047 PSIHOLOGIJA SPORTA - koncepti i primjene
richard h. cox
68254 Socijalna percepcija
Havelka, Nenad - autor
68293 Osnovi socijalne psihologije
Rot, Nikola - autor
68589 3VLKRORJLMDOLюQRVWL
Larsen, Buss
68844 Community Treatment of Drug Misuse: More Than Methadone
Seivewright
70091 Psihodinamska razvojna psihologija : odabrana poglavlja
.RQGLь.VHQLMDDXWRU
70924 Bolesti zavisnosti : pusenje, alkoholizam i narkomanija : 1LNROLь'UDJRVODYDXWRU knjiga za svaku porodicu
70944 Overcoming Teenage Low Mood and Depression : a Nicky Dummett Five Areas Approach
2004 2006 1999
2352.00 4269.00 2317.00
2006 4269.00
2003 3625.00 2007 1120.00
2007 13054.00
1996 8130.00
1993 3660.00
2006 3294.00 2006 1791.00
2003 3508.00
2008 3050.00 2007 7320.00
2007 6005.00
2008 2007 2005 2007 2008
5246.00 5123.00 2683.00 12078.00 6100.00
2000 1996 2009 2009
1886.00 2484.00 5123.00 4370.00
2009 3752.00 2005 810.00
2005 2008 2008 2008 2009
4116.00 648.00 810.00 6791.00 4270.00
2007 1080.00
2007 648.00
2008 2805.00
87 od 116
71127 Career Theory and Practice 71462 Kriza kao sansa : kako pobediti depresiju 71463 Duhovni kapital 71467 Maslina i sta s njom : o sporazumevanju i ponasanju 71470 5HюQLN-XQJRYLKSRMPRYDLVLPEROD 71476 Zdrav zivot u poslovnom svetu 71795 Psychology and Sociology Applied to Medicine, 3 Ed
Swanson,Jane L;Fouad,Nadya A Naneti, Franko - autor Zohar, Dana - autor .QHеHYLю$QD1XгDDXWRU Trebjesanin, Zarko - autor Milna Tudor&tim Beth Alder
2009 3904.00
2008 2008 2007 2008 2008 2009
540.00 1080.00 864.00 5357.00 432.00 3781.00
72541 TREATING CHILD & ADOLESCENT DEPRES CB REY
72618 Oxford Handbook of Learning and Intellectual Disability Gates, Bob; Barr, Owen Nursing, 1 Ed
74219 Children's mental health research
Hoagwood, Kimberly Eaton; Jensen, Peter S.; McKay,
74847 The Developing Child:Plus MyDevelopment Lab Access Card 12ed
Helen Bee Denise Boyd
76567 *sp* Life Span Motor Development
Kathleen Haywood, Nancy Getchell
76573 *sp* Psychology for Physical Educators
Yves Vauden Avweele, Stuart Biddle
76664 2VHьDMLPHUDRSVLKRIL]LюNLPRVQRYDPDVD]QDQMD 2JQMHQRYLь3UHGUDJDXWRU
77317 =ORюLQL]VWUDVWL
.RVWLь0LODQDXWRU
78509 Pkg-Hdev W/Review Card & Pac
Rathus
78512 Pkg-Psych W/Review Card & Pac
Rathus
78861 7DMQDVUHьQHGHFH
Bidalf, Stiv - autor
78862 -RгWDMQLVUHьQHGHFH
Bidalf, Stiv - autor
79167 Personal Conflict Management:Theory and Practice Suzanne Mccorkle
80462 Social Cognition and Developmental Psychopathology Sharp, Carla; Fonagy, Peter; Goodyer, Ian
82720 Psihologija mediji etika - Iskustva i promisljanja za bolju +DGеLVHOLPRYLь'е3ODYгLь
suradnju
Marlena, Pregrad Jase
82806 'H%RQRYNXUVUD]PLгOMDQMDPRьQLDODWNRMLьHYDP De Bono, Edvard - autor SRPRьLGDSURPHQLWHYDгQDюLQUD]PLгOMDQMD
109192 Tajni prsten : Frojdov uzi krug saradnika i politika psihoanalize
Groskurt, Filis - autor
109194 Kompletan uvod u psihoanalizu
Frojd, Sigmund - autor
109304 Vestine vladanja sobom : (kada vam neko ide) na еLYFHDVHUWLYQRVWPDJLюQDUHюEH]PDJLMH
=GUDYNRYLь-H]GLPLUDXWRU
110113 892'832/,7,э.836,+2/2*,-8
M. Cottam, B. Dietz- Uhler, E. Mastors, T. Preston
110343 Forensic Psychology: A Very Short Introduction
Canter, David
110532 1DюHODL]UDGHSVLKRORгNLKWHVWRYD
%XNYLь$OHNVDQGDUDXWRU
112543 2UD]YRMXOLюQRVWL
Jung, Carl Gustav - autor
112545 Destruktivnost i autodestruktivnost mladih
9RMLVODYыXUюLь
113939 The Oxford Handbook of Eating Disorders
Agras, W. Stewart
114211 Performance Psychology,
David John Collins
114927 Sensation, Perception and ActionAn Evolutionary Perspective
Zanker J.
115175 Psihologija invaliditeta
Vash, Carolyn L., Crewe, Nancy M.
115209 PSIHOTERAPIJSKA PEDAGOGIJA
Zdenka Gruden
116296 *5831,352&(6,GLQDPLNDXQXWDULL]PHяXJUXSD rupert brown
117232 Designing and Conducting Mixed Methods Research Creswell,John W;Clark,Vicki
2009 5734.00 2009 2495.00
2009 2814.00
2009 4639.00
2001 2318.00
1998 1830.00
2006 2009 2009 2008 2009 2009 2009 2008
756.00 810.00 4757.00 4391.00 800.00 800.00 3842.00 4746.00
2009 1470.00
1512.00
2009 1296.00
2006 1944.00 2007 432.00
2010 2830.00
2010 2007 2008 2010 2010 2010 2010
999.00 648.00 918.00 864.00 11880.00 4269.00 3049.00
2010 4116.00
2010 1890.00 2006 3528.00 2010 3537.00 88 od 116
L Plano
117585 Measurement and Evaluation in Psychology and Education 8ed
Robert Thorndike Tracy Thorndike-Christ
118460 Agresivnost u djece i mladezi, 2. izdanje
Essau, Cecilia A., Conradt, Judith
118463 $QNVLR]QLSRUHPHьDML
Hollander, E., D. Simeon
118464 $VSHUJHURYVLQGURP±9RGLю]DURGLWHOMHLVWUXюQMDNH Attwood, T.
118465 Trening s agresivnom djecom
Petermann, F., Petermann, Ulrike
118481 SVLKRORгNLYRGLю]DVYDNLGDQVDPR]D pametne
0LOLь0LODQDXWRU
pulmologija
95 *sp* Asthma 3ed: Basic Mechanisms and Clinical Management
Barnes, Rodger, Thomson
259 *sp* Asthma and Allergic Diseases
Marone Et Al
7374 *sp* Respiratory Medicine: An Illustrated Colour Text Selby
8226 *sp* Interleukin-5: From Molecule to Drug Target for Asthma
Colin J. Sanderson
14584 Respiratory System (Netter Collection of Medical Illustrations, Volume 7)
Frank H. Netter,Matthew B. Divertie,Alister Brass
16849 *sp* Tracheostomy : A Multi-Professional Handbook Claudia RusselliBasil Matta
18820 Bolesti pleure
Pongrac Ivan
18838 Pneumonije
Ilija Kuzman
18864 *OMLYLюQHSOXьQHEROHVWL
Ivan Pongrac
18895 Astma
Slavica Dodik
18896 Kako zivjeti sa astmom?
5RVDQD6YHWLьэLгLь
21892 *sp* Textbook of Respitory Medicine
V. Courtney Broaddus,John F. Murray,etc.
24338 Tuberculosis and Nontuberculosis Mycobacterial Infections
Schlossberg
26087 HIGH-YIELD LUNG- IE
DUDEK
26091 MANUAL OF CLINICAL PROBLEMS IN PULMONARY BORDOW MEDICINE 6E-IE
26623 NUKLEARNA KARDIOLOGIJA I PULMOLOGIJA
67HеDN',YDQюHYLь' 'RGLJ,эLNHг
26908 6DUNRLGR]DEROHVWLSOXьQRJLQWHUVWLFLMD
7DWMDQD3HURг*ROXELюLь
37824 Atlas pulmoloske citologije
Ivan Pongrac
39623 *sp* PULMONARY MEDICINE 5E
GEORGE
43787 PULMONARY PATHOPHYSIOLOGY 7E
PB
WEST
47316 Quantitative Skin Testing for Allergy: IDT and MQT
60730 RESPIRATORY PHYSIOLOGY ESSENTIALS 8E PB WEST
61048 Oxford Handbook of Respiratory Medicine (2/e)
Chapman Steven
61069 Paediatric Respiratory Medicine
Hull, Jeremy; Forton, Julian; Thomson, Anne
61739 3OXьQHEROHVWL
6HNXOь6UEROMXE
62012 Pulmonary Circulation 2ed
Peacock, A.J.
62025 Respiratory Emergencies
Alan M Fein
62048 Respiratory Infections
Antoni Torres
62050 Respiratory Genetics
Edwin Silverman
62053 Pulmonary Rehabilitation
Donner et al
71575 Pulmonary Manifestations of Pediatric Diseases,
Nelson L. Turcios
71655 Mosby's Respiratory Care Online for Egan's
Mosby
2009 6038.00
2009 2352.00
2006 2010 2010
2646.00 2205.00 4116.00
2010 756.00
1998 400.00
1998 2002 1999
900.00 1450.00 900.00
1980 7929.00
2004 1994 1999 1998 2005
900.00 700.00 3080.00 1120.00 1260.00 1260.00 22729.00
2005 7320.00
2005 1281.00 2005 3660.00
2005 2800.00
2005 2005 2007 2006 2008 2009 2008
3500.00 4200.00 4270.00 1952.00 3235.00 2196.00 3125.00 4370.00
2000 2700.00 2004 16958.00 2006 17080.00 2006 15738.00 2005 15738.00 2005 15250.00 2009 7807.00 2009 16226.00 89 od 116
Fundamentals of Respiratory Care (User Guide, Access Code, Textbook and Workbook Package),
71656 Mosby's Respiratory Care Online for Egan's Fundamentals of Respiratory Care (User Guide, Access Code and Textbook Package),
Mosby
72226 Oxford Handbook of Respiratory Nursing
Robinson
74202 Oxford Handbook of Respiratory Medicine and Emergencies in Respiratory Medicine Pack
Chapman, Steven; Robinson, Grace; Stradling, John;
74797 Chronic Obstructive Lung Diseases: 2
Norbert, F Voelkel, William Macnee
82118 Harrison's Pulmonary and Critical Care Medicine
Loscalzo
83063 The Respiratory System,
Andrew Davies
111548 Murray and Nadel's Textbook of Respiratory Medicine,2 Robert J. Mason -Volume Set,5ed
113559 The Respiratory System at a Glance 3e
Ward JPT
116057 .OLQLюNDSXOPRORJLMDXSHGLMDWULML
1LNROLь3DVNDODXWRU
118357 Core Topics in Airway Management
Calder/Pearce
119349 5HVSLUDWRUQLWUDNWSULUXюQLN]DWHUDSLMXEROHVWL respiratornog trakta
.DеLь7RPLVODYDXWRU
119872 9RGLюNUR]EURQKRVNRSLMX
7RPLь,OLMDDXWRU
119873 3OHXUDOQLL]OLYLGLMDJQRVWLюNLSULVWXS
Plavec, Goran - autor
radiologija
4212 Pocket Atlas of Radiographic Anatomy
Moeller
4219 Normal Findings in CT and MRI
Moeller
7243 Pocket Guide To Radiography, 5 Ed -IE
Ballinger
10382 *sp* Radiotherapy for Head and Neck Cancer: Indications and Techniques
Adam S., Md Garden, K. Kian Ang, Gardem Adam S
12872 Pocket Atlas of Radiographic Anatomy, 3 Ed
Moeller
14553 Teaching Manual of Color Duplex Sonography
Hofer
14594 Color Atlas of Ultrasound Anatomy
Berthold Block
15286 Spiral and Multislice Computed Tomography of the Body
Cornelia M. Prokop
16485 *sp* Benign Breast Diseases: Radiology-PathologyRisk Assessment
Catherine N. Chinyama
16755 Ultrasound in Emergency Care - IE
Brooks,Adam Brooks,Jim Connolly,OTTO CHAN
17505 The Practice of Ultrasound. A Step-by-step Guide to Berthold Block Abdominal Scanning
18572 Accident & Emergency X-Rays Made Easy IE
Begg
18578 Cross-sectional Imaging Made Easy
Jackson
18942 Radijacijske ozlijede
Damir Dodig
19607 RADIOLOGIJA
Andrija Hebrang, Marijan /RYUHQюLьLVXUDGQLFL
19828 *sp* Practical Guide to Abdominal and Pelvic MRI
Leyendecker, John R.
20193 MRI Principles
Donald G. MitchelliMark Cohen
20574 Introduction to Vascular Ultrasonography,5 Ed
William J. Zwiebel
21698 *sp* Applied Medical Image Analysis Methods
Heang-Ping ChaniLena Costaridou
22305 Thoracic Imaging
Boiselle, Phillip M.
22666 Ultrasound Teaching Manual. The Basics of Performing Matthias Hofer and Interpreting Ultrasound Scans
2009 14884.00
2009 2375.00 2009 5621.00
2009 9149.00
2010 6343.00 2010 3049.00 2010 29158.00
2010 1997 2010 2011
2805.00 260.00 6710.00 648.00
2009 1080.00 2009 1080.00
2000 2000 2003 2002
3775.00 3775.00 1829.00 3500.00
2010 2004 2004 2003
3775.00 4855.00 4315.00 21492.00
2004 4816.00
2004 2745.00
2004 6475.00
2006 2004 2002 2006
1502.00 1092.00 2800.00 1750.00
2004 4000.00 2004 8661.00
2004 9759.00 2005 7259.00
2010 4025.00 2005 4855.00
90 od 116
24057 *sp* IMAGING OF THE AIRWAY FUNCTIONAL AND RADIOLOGIC CORRELATIONS 24289 Emergency Ultrasound 24604 3RPRьXUDGLRORгNRMGLIHUHQFLMDOQRMGLMDJQRVWLFL 24605 92',э.52=0$*1(7185(=21$1&8 ENDOKRANIJUMA 24924 MRI from A to Z 25487 Getting Started in Clinical Radiology 27886 Medical Imaging 30633 *sp* RADIOBIOLOGY FOR THE RADIOL 6E CB 30811 Essential Radiology. Clinical Presentation Pathophysiology - Imaging 30820 Teaching Atlas of Interventional Radiology Nonvascular interventional procedurs 31521 8/75$=98э1,$7/$6'2-.(&'GLIHUHQFLMDOQD dijagnoza i interventne tehnike 34577 Differential Diagnosis in Ultrasound 34743 Abdominal X-Rays Made Easy 2ed - IE 34761 Diagnostic Ultrasound,, 7th Edition 35174 Atlas radioloske anatomije 35175 2VQRYLNOLQLюNHUDGLRORJLMH 35531 Ultrasound in Obstetrics and Gynecology: Volume 2 Gynecology 35533 POCKET ATLAS OF SECTIONAL ANATOMY : COMPUTED TOMOGRAPHY AND MAGNETIC RESONANCE IMAGING (V. 1) : HEAD AND NECK 3 Rev ed 35535 Pocket Atlas of Sectional Anatomy: Computed Tomography and Magnetic Resonance Imaging Volume 2: Thorax, Abdomen, and Pelvis, 3 rev. ed
NAIDICH Karen S. Cosby Stephen Chapman Robert Semnic Liney Eastman,Wald,Crossin Renton HALL Richard B. Gunderman Saadoon Kadir eva pichler Gunter Schmidt Begg Frederick Kremkau Lothar Wicke Eastman, Wald, Crossin Eberhard Merz Moeller, Torsten Bert; Reif, Emil Moeller, Torsten Bert; Reif, Emil
35600 *sp* Radiologic Diagnosis of Gastric Cancer. A New Outlook 36177 Radiation Protection in Medical Radiography, 5th edition 36290 Cost Effective Diagnostic Imaging, 4th edition 37589 CT TORAKSA I ABDOMENA 40013 Diagnostic Imaging: Head and Neck 40827 Diagnostic Imaging: Brain 40991 Diagnostic Imaging: Spine 42258 Diagnostic Imaging: Chest 43281 Diagnostic Imaging: Breast, 43511 Chest X-ray Trainer. A Systematic Teaching Atlas 43513 Clinical 3T Magnetic Resonance 43538 *sp* Advances in Nuclear Oncology: 43653 Diagnostic Imaging: Ultrasound, 43947 Gastrointestinal Imaging, 3rd edition 43948 Sectional Anatomy for Imaging Professionals, 2nd edition 43951 Radiology in Surgical Practice 43952 Internal Derangements of Joints, 2nd edition 43958 Diagnostic Imaging: Nuclear Medicine 43962 Head & Neck Imaging, 2nd edition
L. M. Portnoy Mary Alice Statkiewicz Sh Zachary Grossman Robert Semnic Harnsberger Anne Osborn Ross Jud Gurney Wendie A. Berg Hofer , Bombardieri Anil Ahuja Robert Halpert Lorrie Kelley Susan Neuhaus Donald Resnick Kathryn Morton David Yousem
2005 4270.00
2005 2005 2002
6466.00 2583.00 2700.00
2005 2005 2004 2005 2006
2439.00 4855.00 3049.00 4819.00 5395.00
2006 10795.00
2005 3197.00
2005 2006 2005 2007 2007 2006
18355.00 1228.00 5977.00 1790.00 2190.00 16195.00
2006 3775.00
2006 3775.00
2006 4533.00
2006 4513.00
2006 2005 2004 2004 2004 2006 2006 2006 2008 2007 2007 2006 2007
4757.00 2700.00 22204.00 22082.00 22082.00 22204.00 22936.00 4315.00 4315.00 19673.00 22204.00 7929.00 7319.00
2006 5611.00 2006 35380.00 2007 22936.00 2006 4025.00 91 od 116
43962 Head & Neck Imaging, 2nd edition
David Yousem
43963 Genitourinary Imaging, 2nd edition
Ronald Zagoria
43967 Ultrasound Scanning, 3rd edition
Betty Tempkin
47360 CT Teaching Manual. A Systematic Approach to CT Matthias Hofer Reading
47362 Brain Imaging
Sartor
47430 LANGE Q&A FOR THE RADIOGRAPHY EXAMINATION ISE
SAIA
47790 Merrill's Atlas of Radiographic Positioning and Procedures 3 Volume Set, 11th edition
Eugene Frank
48349 Perez and Brady's Principles and Practice of Radiation HALPERIN Oncology, 5 Ed
48376 Diagnostic and Surgical Imaging Anatomy: Ultrasound Anil Ahuja
48396 Grainger & Allison's Diagnostic Radiology, 5th edition Andy Adam
48401 Gastrointestinal Imaging, 2nd edition
Robert Halpert
48508 Radiologic Differential Diagnosis
Bhargava, Satish. K.
49004 Mri-Guided Focused Ultrasound Surgery
Jolesz Ferenc a
49331 Diagnostic and Surgical Imaging Anatomy: Knee, Ankle, Foot
B. J. Manaster
50386 Ultrasound. A Practical Arrroach to Clinical Problems Edward I. Bluth, Peter H. Arger, Carol B. Benson
50827 Imaging of the Nervous System
Richard Latchaw
51725 Ultrasonography in Vascular Diseases: A Practical Approach to Clinical Problems
Edward I. Bluth, Philip W. Ralls, etc.
51802 Diagnostic Imaging: Emergency
R. Jeffrey
55103 Pocket Guide to Sonography,
Regina Swearengin
55119 Instrumentation, An Issue of Pet Clinics,2-2
Abass Alavi
55121 Imaging of the Chest, 2-Volume Set,
Nestor Muller
55138 Netter's Concise Radiologic Anatomy,
Edward Weber
55145 Computed Tomography,
Euclid Seeram
55147 Radiographic Procedures: a Pocket Index,
Alanah Kirby
55161 Radiology for Surgeons in Clinical Practice
Evis Sala, Alan H. Freeman, David J. Lomas
55162 Learning Diagnostic Imaging. 100 Essential Cases
Ramon Ribes, Antonio Luna, Pablo R. Ros
59895 Churchill Livingstone Pocket Radiography and Medical Chris Gunn Imaging Dictionary
59913 Ultrasound of Fetal Syndromes: Text with DVD
Beryl R. Benacerraf
59931 CT and MRI of the Whole Body, 2-Volume Set
John R. Haaga
59933 Mosby's Comprehensive Review for General Sonography Examinations
Susanna Ovel
59940 An Introduction to Radiography
Suzanne Easton
59943 Radiography and Radiology for Dental Care Professionals
Eric Whaites
59955 Emergency Radiology: The Requisites (Requisites in Jorge A Soto, Brian Lucey Radiology)
59974 Brain Imaging,
Laurie A. Loevner
59987 Breast Cancer Imaging: A Multidisciplinary, Multimodality Approach
Marie Tartar, Chris E. Comstock, Michael S. Kipper
60002 Practical Differential Diagnosis in CT and MRI
60006 Musculoskeletal Imaging (Direct Diagnosis in Radiology)
Maximilian Reiser, Christian Glaser, Andrea Baur-M
60007 The Practice of Breast Ultrasound: Techniques,
Helmut Madjar, Ellen B.
2006 2006 2007 2007
4025.00 4025.00 7319.00 4855.00
2007 4855.00 2006 2471.00
2007 18910.00
2007 24278.00
2007 2007 2007 2007 2007 2007
20252.00 36478.00 4025.00 5489.00 11590.00 18666.00
2007 18355.00
2005 27694.00 2007 5395.00
2007 2007 2008 2008 2008 2008 2008 2008
22204.00 3049.00 5367.00 23546.00 4513.00 6587.00 2927.00 4530.00
2008 4530.00
2007 3171.00
2007 15738.00 2008 28304.00 2008 5977.00
2008 4025.00 2008 2439.00
2008 8417.00
2008 4025.00 2008 13054.00
2008 4315.00 2008 4855.00 2008 14035.00 92 od 116
Findings, Differential Diagnosis
Mendelson
60009 Urogenital Imaging (Direct Diagnosis in Radiology: DX- Bernd Hamm, Dirk
Direct!)
Beyersdorff, Uta Lemke
60010 Breast Imaging (DX-Direct Series)
U. Fischer, F. Baum, S. Luftner-Nagel
60012 Gatrointestinal Imaging. Direct Diagnosis in Radiology Hans-Jьrgen Brambs (DX-Direct Series)
60015 Cardiac Imaging (DX-Direct Series)
Claus Claussen, Stephan Miller, Michael Fenchel
60019 Spinal Imaging (DX-Direct Series)
Herwig Imhof
60020 Head and Neck Imaging (DX-Direct Series)
Ulrich Moedder, Mathias Cohnen, Kjel Andersen
60032 Image-Guided Intervention, 2-Volume Set: Expert Radiology Series
Matthew A. Mauro, Kieran Murphy, Kenneth Thomson
60036 Problem Solving in Musculoskeletal Imaging with CD- William Brian Morrison,
ROM
Timothy G. Sanders
60045 Ultrasonography in Urology: A Practical Approach to Edward I. Bluth, Philip W.
Clinical Problems
Ralls, Carol B. Benson
60759 Mayo Clinic Guide to Cardiac Magnetic Resonance Imaging
McGee
61132 Basic Clinical Radiobiology Fourth Edition
Michael Joiner
61999 Radiologija : univerzitetski udzbenik
-/D]Lь9вRELь6эLNDULь %*ROGQHU5%DELь7
62020 Clark's Positioning in Radiography 12th Edition
Whitley
62032 Computer Aided Tomography Case Histories of the Brain
Dr Karthikeyan
62043 The Physics of Diagnostic Imaging 2ed
Dowsett
62066 ,QWHUSUHWDFLMDUHQGJHQVNLKVQLPDNDSULUXюQLN]D ljekare opste prakse
Palmer. P. E. S.
62084 Radiologija pankreasa
-RYDQRYLь7RPLVODY' autor
62097 8OWUD]YXюQDGLMDJQRVWLNDSULUXюQLN
P.E.S.Palmer,Univerzitet Kalifornija,SAD-prevod Si
62101 Osnovi radioloske zastite : [udzbenik za studente Vise -RYDQRYLь7RPLVODY'
medicinske skole]
autor
62103 Rendgenska dijagnostika bolesti debelog creva
-RYDQRYLь7RPLVODYDXWRU
62280 ER Radiology Trauma Trainer (DVD)/Windows Vista/XP/2000/ME/98
Ole Ackermann, Steffen Ruchholtz, Holger Siemann
65427 EXPERT DIFF DIAG: BRAIN SPINE AMIRSYS CB OSBORN
66316 Imaging of the Temporal Bone
Joel Swartz
66730 Interventional Radiology
Uberoi, Raman
68292 Radioterapija : ilustrovana istorija
эLNDULь6ORERGDQDXWRU
68453 Emergencies in Clinical Radiology
Graham, Richard; Gallagher, Ferdia
68817 Pocket Guide to Chest X-rays
Greg Briggs
68819 Nuclear Cardiology: Technical Applications
Gary V Heller, April Mann, Robert C. Hendel
68833 A-Z of Musculoskeletal and Trauma Radiology
Murray/Holmes/Misra
68834 Clinical Neuroradiology
Hathout/Ferguson
68849 Interventional Radiological Treatment of Liver Tumors Adam/Mueller
68850 Pancreatic Cancer
Heiken
68851 Prostate Cancer
Hricak/Scardino
68865 Aunt Minnie's Atlas and Imaging-Specific Diagnosis, 3 POPE Ed
2008 4855.00
2007 4855.00
2007 4855.00
2008 4855.00
2007 4855.00 2007 4855.00
2008 23546.00
2008 12322.00
2007 7555.00
2008 6710.00
2009 4879.00 2007 3240.00
2005 10370.00 2005 10370.00
2006 9638.00 2004 1620.00
2008 432.00
2006 3564.00
2005 324.00
2004 432.00 2007 5395.00
2008 2009 2009 2006 2009
26718.00 16195.00 4996.00 2700.00 2745.00
2009 3415.00 2009 6099.00
2008 2008 2008 2008 2008 2008
4880.00 10370.00 5490.00 5490.00 5490.00 8052.00
93 od 116
Ed 68867 Nuclear Medicine Technology: Procedures and Quick Reference, 2 Ed 68917 Chest X-Ray Made Easy 3rd-IE
SHACKETT Corne
68938 Expert Differential Diagnosis: Ultrasound 68939 EXPERT DIFF DIAG: ABDOMEN AMIRSYS CB 68940 EXPERTDDX: HEAD AND NECK AMIRSYS CB 68942 EXPERT DIFF DIAG: MUSCULOSKEL AMIRSYS CB 68949 ARTHROGRAPHY RADIOLOGY AMIRSYS CB 68957 Diagnostic Imaging 6e 69024 Paediatric Radiology 69031 Imaging Atlas of Human Anatomy 4th
Ahuja FEDERLE HARNSBERGER MANASTER CRIM Armstrong P Johnson, Karl; Williams, Helen; Foster, Katharine; Weir
69048 Handbook of Medical Image Processing and Analysis, 69628 Practical Digital Mammography 69738 8OWUD]YXюQLDWODVWUEXгQHDQDWRPLMH 70088 0DJQHWQDUH]RQDQFDNLюPH 70800 PHYSICS OF RADIATION THERAPY 4E CB 71191 Ct Colonography: Principles and Practice of Virtual Colonoscopy, 71198 Textbook of Radiographic Positioning and Related Anatomy, 71659 Chest X-Ray Made Easy, 3 Ed 71784 Vascular Ultrasound, 71805 Aids to Radiological Differential Diagnosis, 5 Ed 71826 Digital and Radiographic Imaging, 4th Edition
Isaac Bankman Beverly Hashimoto Berthold Block Robert Semnic KHAN Perry J. Pickhardt Kenneth L. Bontrager Jonathan Corne Abigail Thrush Stephen G. Davies Chris Gunn
72395 Plastic and Reconstrutive Surgery of the Breast: A Surgical Atlas 72444 Temporal Bone Imaging
72446 Interventional Radiology in Women's Health 72449 Teaching Atlas of Musculoskeletal Imaging
72450 Intracranial Sterotactic Radiosurgery 72453 Spine Surgery: Tricks of the Trade
72459 PET and PET/CT: A clinical guide 72471 Pediatric Imaging: Rapid-fire Questions and Answers 72474 Vascular Imaging (Direct Diagnosis in Radiology: DX- Direct!) 72475 Pocket Atlas of Radiographic Positioning (Clinical Sciences (Thieme)) 72476 Atlas of Brain Function 72477 Whole Body MRI Imaging
72478 The Physics of Clinical MR Taught Through Images
72481 Teaching Atlas of Urologic Imaging
73534 RADIOLOGY 101 THE BASICS 3E
PB
73548 DIAGNOSTIC IMAGING: BRAIN 2E AMIRSYS CB
Christian J. Gabka, Heinz Bohmert, Philip Blondeel Ellen G. Hoeffner, Suresh Kumar Mukherji Gary P. Siskin Peter L. Munk, Anthony G. Ryan Alexander R. Vaccaro, Todd J. Albert Eugene C. Lin, Abass Alavi Frank L. Quattromani Karl J. Wolf Torsten Bert Mцller, Emil Reif William W. Orrison Ernst J. Rummeny, Peter Reimer, Walter Heindel Val M. Runge, Wolfgang R. Nitz, Stuart H. Schmeets Robert A. Older, Matthew Bassignani ERKONEN OSBORN
2008 6832.00
2009 1228.00
2009 2008 2009 2008 2008 2009 2009
24278.00 24278.00 26718.00 26718.00 16226.00 4879.00 4746.00
2009 2048.00
2008 2008 2009 2009 2009 2009
13420.00 7555.00 4445.00 3240.00 16226.00 20496.00
2009 12078.00
2009 2009 2009 2008
2195.00 5489.00 3903.00 4025.00
2008 19435.00
2008 9715.00
2009 10795.00 2008 14035.00
2009 16195.00 2008 15115.00
2009 2008 2009
7555.00 4315.00 4855.00
2009 3775.00
2008 7555.00 2009 18355.00
2008 5395.00
2009 12955.00
2009 6100.00 2010 27572.00 94 od 116
73552 CLINICAL IMAGING 5E
CB
EISENBERG
74162 Musculoskeletal Radiology: Past, Present, and Future, Carolyn M. Sofka An Issue of Radiologic Clinics,47-3
74205 Radiotherapy in Practice - Imaging
Hoskin, Peter; Goh, Vicky
74393 Ultrasound Guidance for Nerve Blocks
Marhofer, Peter
74799 McGraw-Hill Specialty Board Review Radiology
Cheri L. Canon
74801 Cases in Pediatric Radiology
Ammar Haouimi
75306 3UDNWLNXPNOLQLюNHUDGLRORJLMH
3HWDU%RгQMDNRYLь'UDJDQ Stojanov; Zoran Radovano
77857 Gastrointestinal Tract Imaging,
Julie Nightingale
77862 Emergency Radiology,
Stuart E. Mirvis
79008 Cardiovascular Magnetic Resonance,2ed
Warren J. Manning
80315 Kompjuterizovana tomografija centralnog nervnog sistema
6DQMD6WRMDQRYLь
80793 Vaskularni ultrazvuk
%RULV%UNOMDюLь
80816 Emergency Radiology
Krishnam/Curtis
80840 8OWUD]YXюQDGLMDJQRVWLNDGLIHUHQFLMDOQDGLMDJQR]D atlas
Guenter Schmidt
80940 Neurosonografska dijagnostika
2EUDGRYLь6ORERGDQ' DXWRUL]GDYDю
80987 Cardiovascular Magnetic Resonance
Myerson, Saul G.; Francis, Jane; Neubauer, Stefan
81245 Radiology Secrets Plus, 3rd Edition
E. Scott Pretorius
2009 17080.00 2009 7807.00
2009 2008 2009 2009 2009
4996.00 3370.00 8661.00 6831.00 1240.00
2009 2009 2010 2007
5001.00 4391.00 11833.00 3564.00
2010 2009 2010
4900.00 3904.00 7990.00
2009 2527.00
2010 4996.00
2010 4635.00
81293 Breast Cancer
Michell
81996 Neuroradiology,3 Ed
David M. Yousem
82110 Essentials of Pediatric Radiology
Daldrup-Link/Gooding
82278 Osnovi radiologije
0DMNOэHQ'MYLG2W/M,OMDQD 5DGRгHYLь-HOLь
82429 Sectional Anatomy: PET/CT and SPECT/CT
82701 DIAGNOSTIC IMAG MUSCL TRAUMA AMIRSYS CB SONIN
83026 Anatomy for Diagnostic Imaging,
Stephanie Ryan
83060 Pediatric Ultrasound,
Rose de Bruyn
110080 Medical Imaging of Normal and Pathologic Anatomy, Joel A. Vilensky
111549 The Teaching Files: Pediatric,
Sarah Milla
111618 Cardiovascular Imaging, 2-Volume Set,
Vincent Ho
111652 Diagnostic Ultrasound, 2-Volume Set,4ed
Carol M. Rumack
111653 Head and Neck Imaging,3ed
David M. Yousem
111875 Chest Radiology,6ed,(Expert Consult - Online and Print)
James C. Reed
2010 2010 2010 2009
6710.00 7929.00 7930.00 1296.00
2010 2010 2010 2010 2010 2010 2010 2010 2010 2010
5758.00 27572.00 6099.00 5489.00 3171.00 10247.00 23546.00 27572.00 4025.00 9149.00
112038 On-Call X-Rays Made Easy International Edition,
Iain Au-Yong
112157 PRAC GUIDE TO ABDOMINAL PELVIC MRI 2E CB LEYENDECKER
112511 Molecular Imaging: Principles and Practice
Ralph Weissleder, Brian D. Ross, Alnawaz Rehemtull
112513 Bedside Ultrasonography in Clinical Medicine
Alexander Levitov, Paul Dallas, Anthony D. Slonim
112515 Basic Radiology, 2nd Edition (Lange Clinical Medicine) Michael Y. Chen, Thomas L. Pope, David J. Ott
112661 Abdominal Ultrasound,
Jane A. Bates
112662 Handbook of Mri Scanning,
Geraldine Burghart
112663 Sonography Principles and Instruments ,8ed
Frederick W. Kremkau
2010 1638.00 2010 11590.00 2010 15493.00
2010 8417.00
2010 6953.00
2010 2010 2010
5245.00 4025.00 6221.00
95 od 116
112740 Teaching Manual of Color Duplex Sonography 112743 Pediatric Imaging (RadCases) 112746 Interventional Radiology (RadCases) 112747 Cardiac Imaging [With Access Code] (RadCases) 112748 Musculoskeletal Radiology (RadCases) 113389 Fetal Radiology: A Diagnostic Atlas 113441 Essential Radiology for Sports Medicine 113763 Introduction to the Science of Medical Imaging 114149 Pocket Atlas of Emergency Ultrasound 114493 Essential Musculoskeletal Mri, 114498 Introduction to Radiologic Technology , 114577 Sonography, 114597 Imaging of Diseases of the Chest, 114919 Functional Magnetic Resonance Imaging 115068 Breast Cancer Imaging Ii, An Issue of Pet Clinics,4-4 115223 Emergency Medicine Sonography: Pocket Guide to Sonographic Anatomy and Pathology 115371 NEUROSONOLOGIJA
Matthias Hofer Richard Gunderman, Lisa Delaney Reinhard Schumacher, Laurie H. Seaver, Jьrgen Spra Bryan Robert Reardon, O. John Ma, James R. Mateer Michelle Anna Wessely La Verne Tolley Gurley Reva Arnez Curry David M. Hansell Huettel S. Sandip Basu Abraham VIDA DEMARIN I DRUGI
2010 5395.00 2010 4482.00
2010 2010 2010 2011
4855.00 4855.00 4855.00 11334.00
2010 18138.00 2009 9150.00 2011 6709.00
2010 2010 2010 2009 2009 2010 2009
4391.00 4391.00 9149.00 22570.00 7075.00 6099.00 2561.00
5496.00
116134 EXAM PREP ULTRASOUND ABDOMEN OBS GYN PENNY PB
116136 DIAG PATHOLOGY SOFT TISSUE AMIRSYS CB FISHER
116652 Gastrointestinal Imaging (RadCases)
Lorenz
116653 Thoracic Imaging (RadCases)
Restrepo
116654 CT Teaching Manual: A Systematic Approach to CT Matthias Hofer Reading
118088 Kolor dupleks sonografija u radioloskoj praksi
=RUDQ/LюDQLQ
118233 Interventional Radiology: a Survival Guide,
David Kessel
118477 Radioloska tehnologija u praksi
Klanfar, Z. i sur
118479 Film i fotokemijska obrada u radiologiji
Klanfar, Z.
119695 Cerebrovaskularne bolesti
6YHWRPLU3,YDQRYLь
120083 8OWUD]YXюQDGLMDJQRVWLNDORNRPRWRUQRJVLVWHPD
/D]DU3HWNRYLь
reumatologija
18883 8ULюQLDUWLWULV
6ODYNRэXQRYLь
18944 Fizijatrijsko reumatoloska propedeutika
,YR-DMLь
19589 PSIHOREUMATOLOSKA DIJAGNOSTIKA U PRAKSI Hartwig Mathies VWUXюQLXUHGQLN7KHRGRU Dьrrigl
26093 MANUAL OF RHEUMATOLOGY AND OUTPATIENT PAGET ORTHOPEDIC DISORDERS 5E-IE
26907 Izvanzglobni reumatizam i srodna stanja
,YR-DMLьL=ULQND-DMLь
30627 Oxford Handbook of Rheumatology (2/e)-IE
Hakim, Alan; Clunie, Gavin; Haq, Inam
43952 Internal Derangements of Joints, 2nd edition
Donald Resnick
47462 CURRENT DIAGNOSIS & TREATMENT IN RHEUMATOLOGY ISE
IMBODEN
55150 Kelley's Textbook of Rheumatology, 8th Edition 2-Volume Set, Expert Consult: Online and Print
Gary S. Firestein
2010 5734.00
2010 2010 2010 2010
23302.00 4173.00 4173.00 5935.00
2010 2010 2009 2010 2010 2008
4320.00 4879.00 3528.00 2352.00 7560.00 918.00
2000 2004 2001
1750.00 2800.00 1050.00
2005 3904.00 2005 3500.00 2006 3375.00 2006 35380.00 2007 4002.00 2008 29768.00 96 od 116
2-Volume Set, Expert Consult: Online and Print
70112 Reumatologija za praksu sa fizijatrijom u reumatologiji 71196 Arthritis and Arthroplasty: The Shoulder (Expert Consult - Online, Print and DVD)
0LRPLU5LVWLь,YDQ =JUDGLь$OHNVDQGDU-RNLь David Dines
2004 1296.00 2009 18056.00
71605 Infections and Rheumatic Diseases, An Issue of Rheumatic Disease Clinics, Volume 35-1
Espinoza
2009 6099.00
74366 Oxford Handbook of Musculoskeletal Nursing
Oliver, Susan
74373 Myotonic Dystrophy (2/e)
Harper, Peter
74733 First Aid for the Orthopaedic Boards, Second Edition Robert A. Malinzak, Mark J.
(First Aid Specialty Boards)
Albritton, Trevor R Pi
110854 Harrison's Rheumatology, Second Edition
Anthony S. Fauci, Carol Langford
111084 Rheumatology, 2-Volume Set: EXPERT CONSULT - Marc C. Hochberg ENHANCED ONLINE FEATURES AND PRINT, 5 Ed
111585 Essential Applications of Musculoskeletal Ultrasound in Richard J. Wakefield Rheumatology,
111615 Fam's Musculoskeletal Examination and Joint Injection George V. Lawry Techniques,2ed
111812 Krizobolja
Grazio S., Buljan D.
111878 Orthopaedics and Rheumatology In Focus,
Ariane L. Herrick
114833 Integrative Rheumatology, Allergy, and Immunology Horwitz, Randy; Muller, Daniel
sportska medicina
6886 *sp* Measurement and Evaluation in Human Performance
James R. Morrow, Allen W. Jackson, James G. Disch
17998 Science of Flexibility
Michael J. Alter
18000 *sp* Research Methods in Physical Activity
Jerry R. ThomasiJack K. Nelson
18874 Sportska medicina
0DUNR3HьLQD
21638 *sp* Sports Medicine
McCann, Peter D.
24370 Preparticipation Physical Evaluation
Physician and Sports Medicine
24371 Bull's Sports Injuries Handbook
William O. Roberts
25372 *sp* Foundations of Sport and Exercise Psychology Weinberg, Robert S.
30424 Kinetic Anatomy: The Essentials of Human Anatomy Robert A. Behnke (Book & CD Rom)
30425 Biomechanics of Sport and Exercise 2 Rev ed
30426 Fitness After 50
Wright, Brenda
30429 *sp* Introduction to Kinesiology
Hoffman, Shirl J.
30516 Disordered Eating Among Athletes
Beals, Katherine A.
36526 Oxford Handbook of Sports and Exercise Medicine MacAuley, Domhnall
37094 Sportska medicina
'XгDQ/HNLь
37344 Fiziologija sporta
'XгDQ/HNLь
37345 Sportska medicina
8UHGQLFL0LFLьL1HгRYLь
43473 An Introduction to Biomechanics of Sport and Exercise James Watkins
46071 Povrede u sportu
GU'UDJROMXE0%DQRYLь
46212 Power Eating: Build Muscle Increase Energy Cut Fat Susan M. Kleiner, Maggie Greenwood-Robinson
46216 Principles and Practice of Resistance Training
Michael Stone; Margaret Stone; William A. Sands
47831 Oxford Dictionary of Sports Science and Medicine (3/e) Kent, Michael
2009 2009 2009
2870.00 1749.00 5367.00
2010 5245.00
2010 29402.00
2010 14518.00
2010 7563.00
2009 2009 2010
4116.00 2195.00 3439.00
2000 2953.00
2004 4819.00 2001 3019.00
2003 2004 2004
1120.00 6661.00 2927.00
2004 2005 2006
4757.00 2974.00 5206.00
2005 2006 2005 2004 2006 2001 2001 2002 2007 2006 2006
6094.00 1707.00 3288.00 3721.00 2750.00 810.00 810.00 1080.00 3415.00 2862.00 1585.00
2007 6039.00
2006 999.00 97 od 116
48056 Athletic Abs
Cole, Scott; Seabourne, Tom
48394 Physical Therapies in Sport and Exercise, 2nd edition Gregory Kolt
48438 Dance Anatomy and Kinesiology
Clippinger, Karen
48442 Practical Sports Nutrition
Louise Burke
48448 Physical Activity and Health
Claude Bouchard, Steven Blair, William Haskell
48511 Current Diagnosis and Treatment in Sports Medicine McMahon, Patrick J (Lange Medical Books)
48569 Fitness Professional's Handbook
Edward T. Howley; B.Don Franks
48701 Planet Health 2 Rev ed
Carter, Jill; Gortmaker, Steven Lawrence; Nobrega,
49332 ACSM's Primary Care Sports Medicine
Douglas B. McKeag, James L. Moeller
53533 Christian Paths to Health and Wellness
53535 Endurance Sports Nutrition 2 Rev ed
55836 Kineziterapija sustava za kretanje
Dr. se. Zdenko Kosinac
59932 Delee & Drez's Orthopaedic Sports Medicine: Principles and Practice (Hardcover)
Jesse Delee
60000 Sports Injury Outcomes and Prevention, An Issue of Joseph M. Hart Clinics in Sports Medicine (The Clinics: Orthopedics)
60112 *sp* Martindale's Drugs Restricted in Sport 2008 Pocket Companion
60373 Essentials of Strength Training and Conditioning 3rd Thomas Baechle and Roger
Edition
Earle
61854 Fitnes kuharica
Hubert Horn i Gert Schill
61862 Joga kuharica
Sivananda Vedanta joga centri
61867 Mentalni trening za sportase
Terry Orlick, PhD
61883 Periodizacija - teorija i metodologija treninga
Tudor Bompa
61952 Sportska prehrana, 2 Ed (meki uvez)
Nancy Clark
62093 Steroidi
W.Nathaniel Phillips
62108 Stretching - Vjezbe istezanja
Bob Anderson
62116 8PMHWQRVWOLMHюHQMDVSRUWVNRPPDVDеRP
Joan Johanson
62152 Vezbanje i zdravlje
Brian J. Sharkey, Steven E. Gaskill
63517 Gymnastics and Politics: Niels Bukh and Male Aesthetics
Hans Bonde
64367 ENGLISH IN SPORTS
0LUD00LOLь
65863 9RGLю]DLVKUDQXVSRUWLVWDEROMLVSRUWVNLUH]XOWDWLYLгH Fajl, Vofgang - autor PLгLьDPDQMHPDVQRJWNLYDEH]VODELKWDюDNDQD WHWLYDPDPLгLьLPD
67752 ,VSLWLYDQMHVQDJHPLгLьDPDQXHOQDPHWRGD
Zec, Zivojin - autor
68047 PSIHOLOGIJA SPORTA - koncepti i primjene
richard h. cox
68262 BIOMECHANICAL BASIS HUMAN MOVE 3E CB HAMILL
68282 SPORTS MEDICINE & REHABILITATION 2E CB BUSCHBACHER
68848 Sports Medicine
Drez, Jr./Bach, Jr/Nofsin
69015 ACSM's Guidelines for Exercise Testing and Prescription 8E
ACSM
69016 ACSM's Exercise is Medicine: A Clinician's Guide to ACSM Exercise Prescription
69108 The Athlete's Shoulder,
James Andrews
2002 1463.00
2007 2007 2007 2006
9271.00 4392.00 6039.00 6094.00
2006 4635.00
2007 6039.00
2007 3567.00
2007 9760.00
2007 2007 2008 2008
2501.00 1463.00 3888.00 32696.00
2008 7807.00
2008 490.00
2008 6039.00
1862.00 2170.00
2009 2008 1997 2008
1944.00 3456.00 2700.00 1944.00 1836.00 1836.00 1595.00
2006 5904.00
2007 2006
832.00 756.00
2007 2005 2008 2008 2008 2009
594.00 4116.00 4757.00 10126.00 4270.00 2434.00
2009 4026.00
2008 12566.00 98 od 116
69423 Foundations of Sport And Exercise Psychology 70302 Osnove sportske medicine 71689 Netter's Sports Medicine, 74188 Sports Development and Sports Polic
Robert S. Weinberg, Daniel Gould Richard Higgins, Peter Brukner, Bryan English Christopher Madden Bloyce
2007 6039.00 2009 1095.00 2009 7929.00 2009 3049.00
74211 Sports Injury Research 74508 Nutrition for Health, Fitness & Sport 74789 McGraw-Hill's NPTE (National Physical Therapy Examination) (Lange) 75053 Hard Work:Defining Physical Work Performance Requirements 76572 *sp* Statistics in Kinesiology
Verhagen, Evert; van Mechelen, Willem Melvin H Williams Mark Dutton Brian J. Sharkey, Paul O. Davis William J. Vincent
2009 4370.00 2009 5611.00 2009 6221.00 2008 5612.00 1999 1342.00
76751 Clinical Sports Medicine Book (Revised) & Clinical Sports Medicine DVD Package
Brukner
2009 9149.00
77995 Cardiovascular Physiology in Exercise and Sport, 78000 Baxter's The Foot and Ankle in Sport,
Christopher Bell David A. Porter
2008 2683.00 2007 15372.00
82871 Sport Mechanics for Coaches 83231 Fundamentals of Sport and Exercise Psychology (Human Kinetics' Fundamentals of Sport and Exercise Science Series)
Brendan Burkett Alan S. Kornspan
2010 3166.00 2009 2195.00
83237 Soft Tissue Release: Hands-on Guides for Therapists 110109 Sports Emergencies, 110363 Clinical Sports Nutrition 110891 Essentials of Exercise Physiology 4E (INT ED) PB 113867 Rehabilitation Techniques for Sports Medicine 113967 Fundamentals of Sport and Exercise Nutrition (Fundamentals of Sport and Exercise Science) 113968 The Nutrient Timing for Peak Performance 117217 5-MINUTE SPORTS MEDICINE CONSULT 2E CB
Jane Johnson John M. O'byrne Louise Burke MCARDLE Prentice Marie Dunford Heidi Skolnik, Andrea Chernus BRACKER
2009 2010 2010 2010 2010 2010
1829.00 3903.00 5489.00 3659.00 5001.00 2434.00
2010 1585.00
2011 7198.00
stomatologija
26271 Smile Design
Chiche, Gerard J.
2004 9516.00
37046 Mastering Digital Dental Photography 40210 Netter's Head and Neck Anatomy for Dentistry 61955 'HюMDVWRPDWRORJLMD 74224 Orofacial Pain
Bengel, Wolfgang Neil Norton Dragan Beloica Zakrzewska, Joanna M.
2006 2006 2005 2009
14640.00 3781.00 1620.00 3745.00
78785 Head and Neck Anatomy for Dental Medicine
Michael Schьnke, Erik Schulte, Udo Schumacher
2010
114948 Oral and Maxillofacial Surgery
Andersson L
2010
stomatologija-bolesti zuba sa endodoncijom (restaurativna stomatologija)
6475.00 21959.00
8482 Dentin adhezivna sredstva u stomatologiji 19809 Essentials of Dental Caries (3/e)
6ODYROMXEдLYNRYLь Kidd, Edwina
2007 1190.00 2005 3375.00
25489 Pocket Atlas of Endodontology
Rudolf Beer
26270 Adhesive Technology for Restorative Dentistry
Jean-Francois Rouleti
31323 Practical Clinical Endodontics
Lumley
35176 .OLQLюNDHQGRGRQFLMD
Tronstad
35694 Fundamentals of Operative Dentistry: A Contemporary Hilton, Thomas J.; Robins,
Approach, 3 Ed
J. Williams; Schwartz,
2005 2004 2006 2007 2006
3775.00 8906.00 5611.00 1990.00 6832.00
49337 Minimally Invasive Dentistry: The Management of Caries
Wilson, Nairn H.F.; Wilson, Nairn H.F.
2007 6710.00
99 od 116
53601 Biologija pulpe i dentina u restaurativnoj stomatologiji 55117 Endodontics: Principles and Practice, 4 Ed 59559 Successful Posterior Composites (Quintessentials of Dental Practice) 60930 Ingle's Endodonics 68980 Endodontic Microbiology 69704 Practical Lessons in Endodontic Treatment 69710 Esthetics with Resin Composites: Basics and Techniques 72402 Clinical Endodontics: A Textbook 74722 PDQ Endodontics 75150 Clinical Success in Endodontic Retreatment 75163 Endodontic Microsurgery 75411 Osnovi restaurativne stomatologije 75418 Solutions for Dental Esthetics: The Natural Look 76858 Textbook of Endodontology 2e 82715 (QGRGRQFLMD1DюHODLSUDNVD 83054 Cohen's Pathways of the Pulp Expert Consult, 10th Edition
Ivar A. Mjor Mahmoud Torabinejad Christopher Lynch Ingle, Bakland, Baumgartner Fouad AF Donald E. Arens Burkard Hugo Leif Tronstad John I. Ingle Stephane Simon Enrique Merino 6ODYROMXEдLYNRYLь Toyohiko Hidaka Bergenholtz G Torabinejad, Walton Kenneth M. Hargreaves
108965 Osnovi zubnog karijesa
Edwina A. M. Kidd
109365 Removable Partial Dentures
Garcia LT
109373 Problem Solving in Endodontics,
James L. Gutmann
110105 Harty's Endodontics in Clinical Practice Text and Evolve ebooks Package,
Bun San Chong
VWRPDWRORJLMDGHюMDVWRPDWRORJLMD
20188 Clinical Problem Solving In Paediatric Dentistry And Orthodontics
Declan Millett
49339 Community Oral Health
Harris; Pine
59990 Handbook of Pediatric Dentistry
Cameron, Widmer
68023 3HGRGRQFLMDNOLQLюNLSULVWXS
Goran Koch, Sven Poulsen
76553 Pediatric Dentistry - A Clinical Approach 2e
Koch G
82979 Case Reports in Paediatric Dentistry
Evert van Amerongen
83051 Mcdonald and Avery Dentistry for the Child and Adolescent, 9 Ed
Jeffrey A. Dean
109359 Early Childhood Oral Health
Berg J
stomatologija-multidisciplinarno
6027 *sp* Dental Practitioners` Formulary 2002-2004
19807 Integrated Dental Treatment Planning: A Case Based ELIZABETH J. KAY,Ann C.
Approach
Shearer,A.
Bridgman,Gerald
26273 Dentists Who Care: Inspiring Stories of Professional James T. RuleiMuriel J.
Commitment
Bebeau
30613 Oxford Handbook of Dental Patient Care
Scully, Crispian
36242 Legal Aspects of General Dental Practice
Len D'Cruz
38924 Precision in Dental Esthetics
Massironi, D
43983 Churchill's Pocketbooks Clinical Dentistry, IE 3 Ed
Chestnutt
44064 *sp* Lexi-Comp's Drug Information Handbook for Dentistry
Wynn, Meiller, Crossley
46933 5MHюQLNHQJOHVNRQMHPDюNRKUYDWVNLVWRPDWRORгNL
0DULQ9RGDQRYLь
48197 Successful Esthetic and Cosmetic Dentistry for the
J. Calamia
2008 2008 2008
2495.00 9149.00 3416.00
2008 13175.00
2009 10369.00 2009 10004.00 2009 19276.00
2008 2009 2009 2009 2009 2008 2009 2010 2010
5395.00 3659.00 10004.00 20008.00 2790.00 8296.00 9759.00 11025.00 11833.00
2010 2009 2010 2010
1590.00 7685.00 9149.00 6587.00
2005 4879.00
2007 2008 2005 2009 2009 2010
6100.00 5855.00 11025.00 10979.00 8784.00 8539.00
2009 8539.00
2002 400.00 2005 3120.00
2005 2074.00
2005 2006 2006 2007 2007
2875.00 5367.00 19154.00 2185.00 900.00
2005 4714.00 2007 6831.00 100 od 116
Modern Dental Practice, An Issue of Dental Clinics 49341 Hypnosis and Communication in Dental Practice 49346 A Dental Treasure Chest: Tips And Tricks for Daily Practice 51061 Mosby's Dental Dictionary, 2nd edition 55122 Dental Instruments, 3 Ed A Pocket Guide
Potter; Simons; Temple Bucking, Wolfram Mosby Linda Bartolomucci Boyd
2007 4636.00 2006 11102.00 2007 3415.00 2008 3415.00
58845 Kontrola infekcije u stomatoloskim ustanovama 59531 Evidence-based Dentistry: Managing Information for Better Practice (Quintessentials of Dental Practice) 60618 Stedman's Medical Dictionary for the Dental Professions 68985 Dentist's Guide to Medical Conditions and Complications 70638 Orofacijalna genetika 71640 Mosby's Dental Drug Reference, 9 Ed 71712 Infection Control and Management of Hazardous Materials for the Dental Team, 4th Edition
9DQMD9XюLьHYLь%RUDV Derek Richards, Jan Clarkson, Debora Matthews Stedman Ganda K ,OLMDвNULQMDULь Mosby Chris H. Miller
2008 840.00 2008 3416.00
2007 3044.00
2008 4879.00
2006 2009 2009
5564.00 4025.00 4269.00
72251 Oxford American Handbook of Clinical Dentistry 72615 Oxford Handbook of Clinical Dentistry (5/e) 74897 Kompjuterska stomatologija 75142 Change Your Smile: Discover How a New Smile Can Transform Your Life 75418 Solutions for Dental Esthetics: The Natural Look 76538 Clinical Problem Solving in Dentistry, 3 Ed 76700 Oral Pathology for the Dental Hygienist, 5th Edition
Da Silva L.Mitchell; D. Mitchell %0LKDLORYLь00LODGLQRYLь '0ODGHQRYLь=/D]Lь Ronald E. Goldstein Toyohiko Hidaka Edward W Odell Olga A. C. Ibsen
2007 2009 2009 2009 2008 2010 2008
3125.00 2750.00 1377.00 2410.00 8296.00 4879.00 6831.00
82489 Medical Problems in Dentistry,6 Ed
Crispian Scully
109900 1HPDюNRVUSVNLUHюQLNXVWDL]XEL 'HXWVFK serbische Wцrterbuch : Mund und Zдhne
6LPLь0LORUDGDXWRU L]GDYDю
110106 Pharmacology and Therapeutics for Dentistry,
John A. Yagiela
115360 GERONTOSTOMATOLOGIJA
stomatologija-opstemedicinski predmeti u stomatologiji
50087 Otorinolaringologija za studente stomatologije
'RFGU,YLFD3HQяHU
57998 Neurologija za stomatologe
Demarin, Trkanjec
stomatologija-oralna histologija
68916 Oral Anatomy, Histology & Embryology 4thed -IE
Berkowitz
2010 8539.00 2004 216.00 2010 7929.00 2010 2660.00 2006 1188.00 2008 2786.00 2009 3825.00
115237 Osnovi oralne histologije i embriologije
James K. Avery, Daniel J Chiego
115238 Osnovna i oralna histologija i embriologija
9HVQD/DюNRYLь,YDQ 1LNROLь9HUD7RGRURYLь
stomatologija-oralna i maksilofacijalna hirurgija
19547 Oralna hirurgija
/M7RGRURYLь93HWURYLь 0-XULгLь
26516 Praktikum oralne hirurgije
$0DUNRYLь6эROLь0 5DGXORYLьLGUXJL
32819 Atlas oralne hirurgije
3URIGU9ODVWLPLU3HWURYLь
50574 Anestezija u stomatologiji
/M7RGRURYLь93HWURYLь= 6WUDMюLь.$YUDPRYLь
0.00 0.00 2007 2052.00 2003 1691.00 2006 2990.00 2003 648.00 101 od 116
56573 Illustrated Lecture Notes in Oral and Maxillofacial Surgery
George Dimitroulis
59522 Cone-beam Volumetric Imaging in Dental, Oral and Joachim Zoller, Jorg Maxillofacial Medicine: Fundamentals, Diagnostics and Neugebauer Treatment Planning
59968 Oral and Maxillofacial Surgery: 3-Volume Set
Fonseca, Turvey, Marciani
60189 Fundamentals Of Orthognathic Surgery, 2 Ed
Malcolm Harris
68521 Hemostaza u stomatoloskoj praksi
3HURYLь-RYDQ9DXWRU
72963 Oral and Maxillofacial Surgery, Vol 1
Raymond J. Fonseca
74896 Krvarenje i hemostaza u oralnohirurskoj praksi
%9XMLюLь/0DюXNDQRYLь *ROXERYLь
75153 Clinical Success in Bone Surgery with Ultrasonic Devices
Marie G. Poblete-Michel, Jean-Francois Michel
76872 Local Anaesthesia in Dentistry
Baart JA
76873 Clinical Sedation in Dentistry
Girdler NM
108891 Bone Reformation: Contemporary Bone Augmentation Stefan Lundgren, Lars Procedures in Oral and Maxillofacial Implant Surgery Sennerby
110107 Principles and Practice of Laser Dentistry,
Robert A. Convissar
110347 Oxford Textbook of Anaesthesia for Oral and Maxillofacial Surgery
Shaw, Ian; Kumar, Chandra; Dodds, Christopher
stomatologija-oralna implantologija
8506 Oralna implantologija
3HURYLь-RYDQ9
29663 Bone Grafting Techniques for Maxillary Implants
Kahnberg
49345 Bone Augmentation in Oral Implantology
Antoun, Hadi; Khoury, Fouad; Missika, Patrick
58713 Oralna implantologija
-XULгLь0LODQ6WDPHQNRYLь 'UDJRVODY0DUNRYLь$OH
59528 ITI Treatment Guide: Loading Protocols in Implant Dentistry - Partially Dentate Patients v. 2
59560 The Art of Computer-guided Implantology
Tardieu, Rosenfield
68978 Implant Restorations - A Step-by-Step Guide
Drago C
75145 Oral and Implant Surgery: Principles and Procedures Thomas Lambrecht
76857 Implant and Regenerative Therapy
Fugazzotto PA
81246 Color Atlas of Dental Implant Surgery,3ed
Michael S. Block
82393 Esthetics in Implantology
Jose B. Das Neves
82397 Dental Implants, 2nd Edition The Art and Science
Charles A. Babbush
82398 Atlas of Oral Implantology,
Pankaj Singh
111553 Implant Dentistry,2ed
Arun K. Garg
116006 Dental Implant Complications - Etiology Prevention and Treatment
Froum S
116007 Implant Laboratory Procedures - A Step-By-Step
Drago C
stomatologija-oralna medicina
20564 Treatment of Oral Diseases
Laskaris, George
21816 3ULUXюQLNRUDOQLKEROHVWL
99%RUDV$QяD5DLю
37595 Burketova oralna medicina, 10. izdanje
Greenberg & Glick
48515 Burket's Oral Medicine, 11 Ed
Greenberg, Glick, Ship
55102 Oral Pathology:Clinical Pathologic Correlations 5e, IE Regezi, Sciubba & Jordan
55107 Oral and Maxillofacial Medicine, 2nd Edition The Basis of Diagnosis and Treatment
Crispian Scully
2008 13176.00 2008 14396.00
2008 2008 2002 2008 2009
49532.00 7906.00 648.00 21106.00 1690.00
2009 8540.00
2008 2009 2008
4269.00 4269.00 8296.00
2010 12566.00 2010 11880.00
2004 648.00 2005 9760.00 2006 21594.00
2008 6480.00
2007 7442.00
2009 2007 2009 2009 2010 2009 2010
12810.00 6831.00 19520.00 10125.00 16470.00 15616.00 18056.00
2009 17202.00 2009 10247.00 2010 12809.00 2010 7319.00
2005 2005 2006 2008 2008 2008
5395.00 2800.00 9800.00 6709.00 6694.00 5977.00
102 od 116
55744 Oralna medicina-praktikum 58081 Salivary Diagnostics 60303 Cawson's Essentials of Oral Pathology and Oral Medicine, International Edition, 8th Edition
SURI-DQNRYLь/MLOMDQD Wong D Cawson
61238 Atlas bolesti usta
'XNDQRYLь'DMLь
62002 Preventivna stomatologija
9XORYLь
65983 Bolesti usta
DMLь'UDJROMXEDXWRU
68864 Color Atlas of Common Oral Diseases, 4 Ed
LANGLAIS
74200 Applied Medicine and Surgery in Dentistry (3/e)
Scully, Kalantzis
75460 Lexi-Comp's Oral Soft Tissue Diseases Manual: A Reference Manual for Diagnosis and Management, 4 Ed
NEWLAND
83753 Dental Practice: Get in the Game
Okuji
stomatologija-oralna mikrobiologija
62001 Oralna mikrobiologija
Pavlica, Dusan - autor
68980 Endodontic Microbiology
Fouad AF
76874 Oral Microbiology at a Glance
Lamont R
81188 Stomatoloska mikrobiologija
9ODGLPLU3UHVHюNL
stomatologija-ortodoncija (ortopedija vilica)
21727 The Orthodontic Patient
Ireland, A.J.
22687 Orthodontics: Current Principles and Techniques, 4 Ed Thomas M. Graber
25488 *sp* Orthodontic Pearls &Tricks
Mizrahi
43528 Contemporary Orthodontics,4 Ed
William R. Proffit
65814 2UWRGRQWVNLSDFLMHQWOHюHQMHLELRPHKDQLND
Anthony J. Ireland, Fraser McDonald
71822 Tip-Edge Orthodontics and the Plus Bracket, 2nd Edition
Richard Parkhouse
82716 Ortodoncija
Proffit, Fields, Server
113706 Clinical Problem Solving in Orthodontics and Paediatric Declan Millett Dentistry Text and Evolve ebooks Package,2 Ed
114040 Diagnosis and Treatment of Simple Orthodontic Problems
Staley R
114043 Three-Dimensional Imaging for Orthodontics and Maxillofacial Surgery
Kau CH
114130 Manual of Wire Bending Techniques
Elichiro Nakajima
stomatologija-parodontologija
19719 *sp* Fundamentals of Peridontal Instrumentation and Nield-Gehrig, Jill S. Advanced Root Instrumentation
20559 Periodontology
Mueller
23612 Color Atlas of Dental Medicine, Vol.1 : Periodontology Klaus H. Rateitschak
25766 Periodontics, An Issue of Dental Clinics
Scannapieco
45365 Fundamentals of Periodontal Instrumentation and Advanced Root Instrumentation (Spiral-bound)
Nield-Gehrig
46989 Reinforced Periodontal Instrumentation and Ergonomics for the Dental Care Provider
MILLAR
61235 Atlas paradontologije
'DMLь'XNDQRYLь
61236 Parodontologija
'XNDQRYLю'DMLь
68979 Practical Advanced Periodontal Surgery
Dibart S
75418 Solutions for Dental Esthetics: The Natural Look
Toyohiko Hidaka
79278 Periodontics, 6th Edition
Barry M. Eley
2007 2008 2008
490.00 9150.00 3551.00
2008 2005 2008 2009 2009 2008
3456.00 1728.00 4320.00 3654.00 4125.00 5734.00
2010 3904.00
2008 2009 2010 2009
335.00 10369.00 3049.00 5320.00
2003 2005 2004 2007 2010
4250.00 18544.00 6832.00 10979.00 1790.00
2008 13298.00
2010 17640.00 2010 5367.00 2010 6099.00 2010 11590.00 2010 7930.00
2004 1500.00
2005 2005 2005 2007
4855.00 21595.00 5977.00 4264.00
2007 2135.00
2006 2916.00 2006 972.00 2007 4879.00 2008 8296.00 2010 6953.00 103 od 116
80537 Parodontologija
Wolf, Rateitschak-Plьss, Rateitschak,
114589 Carranza's Clinical Periodontology Expert Consult, 11th Michael G. Newman Edition Text with Continually Updated Online Reference
stomatologija-stomatoloska protetika
8297 The Science and Art of Porcelain Laminate Veneers Galip Gurel
8368 Introduction to Metal Ceramic Technology
Naylor
42256 7HPSRURPDQGLEXODUQLSRUHPHьDMLLVWRPDWRORгND protetika
Tomislav Badel
50085 Stomatoloska protetika- parcijalne proteze
'UDJRVODY6WDPHQNRYLь
50180 Clinical Problem Solving in Prosthodontics
David Bartlett
53855 7HPSRURPDQGLEXODUQLSRUHPHьDMLLRNOX]LMDL]G
2NHVRQ9DOHQWLь3HUX]RYLь
56111 ESTHETIC REHABILITATION IN FIXED PROSTHODONTICS, Vol 2: Prosthetic Treatment, a Systematic Approach to Esthetic, Biologic, and Functional Integration: 2
Mauro, M.D. Fradeani, Giancarlo Barducci
61957 Bezubost : klinika, dijagnoza, tretman
6RNRORYLь%XGLPLU
75418 Solutions for Dental Esthetics: The Natural Look
Toyohiko Hidaka
98837 Clinical Success in Immediate Complete Dentures: An Michel I. Pompignoli, Michel
Alternative Approach
Postaire, Didier Raux
stomatologija-stomatoloska radiologija
47309 Pocket Atlas of Dental Radiology
Pasler, Visser
59943 Radiography and Radiology for Dental Care Professionals
Eric Whaites
66281 Oral Radiology 6th ed
White
75177 Colour Atlas of Cone Beam Volumetric Imaging for Dental Applications
Dale A. Miles
83066 Radiology for the Dental Professional,
Herbert H. Frommer
111558 Radiology for the Dental Professional - Text and Study Herbert H. Frommer Guide Package,9ed
114043 Three-Dimensional Imaging for Orthodontics and Maxillofacial Surgery
Kau CH
stomatologija-stomatoloski materijali
31404 Craig's Restorative Dental Materials, 12th edition
Powers
48404 Introduction to Dental Materials, 3rd edition
Richard Van Noort
59901 Dental Materials: Properties and Manipulation (Dental John M. Powers, John C.
Materials: Properties & Manipulation (Craig))
Wataha
68983 Applied Dental Materials 9e
McCabe J
75419 Introduction to Metal-ceramic Technology
Patrick Naylor
76877 Basic Guide to Dental Materials
Scheller-Sherid C
83067 Dental Materials,
Carol Dixon Hatrick
91296 Tooth Whitening in Esthetic Dentistry: Principles and So-Ran Kwon, Seok-Hoon
Techniques/Communication Tools
Ko
109696 Clinical Aspects of Dental Materials, 3e
Gladwin/ Bagby
stomatologija-urgentna stomatologija
42537 Medical Emergencies in the Dental Office, 6th edition Stanley Malamed
70830 First Aid A&A for the NBDE Part I 1ed ISE
Steinbacher
2009 17640.00 2011 11833.00
2003 18056.00 6222.00 2007 4200.00
2006 2003 2008 2008
4860.00 4513.00 6300.00 28060.00
1997 2008 2008
1620.00 8296.00 6344.00
2007 3775.00 2008 2439.00 2008 4098.00 2009 11956.00 2010 5367.00 2010 6709.00 2010 11590.00
2006 2007 2007
7075.00 5367.00 5001.00
2008 2009 2010 2010 2008
4513.00 8296.00 2927.00 4879.00 13176.00
2010 5124.00
2007 6709.00 2009 2190.00
76878 Basic Guide to Medical Emergencies in the Dental Practice
Jevon P
2009 2805.00
104 od 116
120806 Urgentna medicina u stomatoloskoj praksi : prvi kontakt 9XюRYLь'UDJDQDXWRU EROHVQLNDVDOHNDURPXYHOLNRMPHULUHгDYDLL]OHюHQMH
toksikologija
2751 *sp* Lehrbuch der Toxikologie
Marquardt
17791 Dreisbach's Handbook of Poisoning
Dreisbach, Robert H.
24607 7URYDQMDSUHYHQFLMDGLMDJQR]DLOHюHQMH
Robert Dreisbach, BevLorraine
30953 Pharmaceutical Toxicology
G J Mulder & L Dencker
36003 Free Radicals in Biology and Medicine (4/e)
Halliwell, Barry; Gutteridge, John
39626 MANUAL OVERDOSES & POISONINGS
IRWIN
49011 Clarke's Analytical Forensic Toxicology
Edited by Sue Jickells
51134 CASARETT AND DOULL'S TOXICOLOGY : THE BASIC SCIENCE OF POISONS 7 Rev ed
Klaassen, Curtis D.
60148 Biomarker Methods in Drug Discovery and Development (Methods in Pharmacology and Toxicology)
60770 A Guide to Practical Toxicology: Evaluation, Prediction, Adam Woolley and Risk, Second Edition
61740 Toksikologija
-RNDQRYLь0LODQDXWRU
112492 CASARETT & DOULL'S ESSENTIALS OF TOXICOLOGY
WATKINS III
2011 1728.00
2001 2005
400.00 4269.00 1790.00
2006 3837.00 2007 5940.00
2005 2678.00 2008 5123.00 2007 11590.00
2008 11334.00
2008 6100.00 2001 1080.00 2010 5245.00
116706 Illustrated Handbook of Toxicology
Franz-Xaver Reichl
urgentna medicina
16755 Ultrasound in Emergency Care - IE
Brooks,Adam Brooks,Jim Connolly,OTTO CHAN
16914 Emergency Triage - IE
Not Applicable (Na )
18926 Ozljede prsnog kosa
7RPLVODY9ODGRYLь5HOMD
24289 Emergency Ultrasound
Karen S. Cosby
32927 Urgentna medicina
$UJLURYLь5DGRMND $WDQDVLMHYLь7DWMDQD%DMHF RU
34778 Lecture Notes: Emergency Medicine, 3 Ed - IE
Moulton
36182 Signs and Symptoms in Emergency Medicine, 2nd edition
Mark Davis
36983 FORENSIC EMERGENCY MEDICINE 2E
OLSHAKER
39625 *sp* Primary Care Medicine: Office Evaluation and Management of the Adult Patient,5 Ed
GOROLL
47437 JUST THE FACTS IN CRITICAL CARE MEDICINE ISE HALL
2011 7555.00
2004 2745.00
2006 2000 2005 2002
1824.00 2100.00 6466.00 4633.00
2006 1830.00 2006 4025.00 2006 7808.00 2005 2500.00 2007 3033.00
47441 Wound Care Essentials: Practice Principles
Sharon Baranoski, Elizabeth A. Ayello
53889 CURRENT DIAGNOSIS AND TREATMENT: EMERGENCY MEDICINE
STONE
59935 Oh's Intensive Care Manual
Bersten , Soni
61051 Emergencies in Clinical Medicine
Page, Piers; Skinner, Greg
61129 Trauma Care Manual Second Edition
Ian Greaves
61642 FIRST AID FOR THE EMERGENCY MEDICINE BOARDS (First Aid Specialty Boards)
Barbara Blok, Dickson Cheung, Timothy Fortescue P
61996 Urgentna stanja u internoj medicini : prehospitalni i rani 6LPHXQRYLь6ODYLFD hospitalni
62013 Maintaining Control: An Introduction to the Effective John Edward Gillett
2007 3044.00
2007 3415.00
2008 2008 2008 2008
8051.00 2745.00 4269.00 5489.00
2008 1080.00 2003 2805.00 105 od 116
Management of Violence and Aggression 62025 Respiratory Emergencies 62100 Urgentna medicina : brzi pregled 64331 9RGLю]DSUHKRVSLWDOQR]EULQMDYDQMHSRYUHяHQRJ pacijenta 64335 Praktikum urgentne medicine 64337 Urgentna medicina kroz primere iz prakse 64340 3UYDSRPRь 65455 Family Medicine: Ambulatory Care and Prevention, Fifth Edition: Ambulatory Care and Prevention (Lange Clinical Medicine) 66415 Procedures in Critical Care 66432 DEJA REVIEW: EMERGENCY MEDICINE-ISE 66481 Oxford Handbook of Clinical Medicine and Emergencies in Clinical Medicine Pack 68455 Emergencies in Trauma and Orthopaedics 69264 8UJHQWQLSRUHPHьDMLGLVEDODQVDYRGHLHOHNWUROLWD YRGLюNUHDWLYQHGLMDJQRVWLNHVWHSE\VWHSSURWRNRO UHгDYDQMHGLMDJQRVWLюNLKGLOHPDSULPHQDUDFLRQDOQH reanimacije 69285 Zavoji 69622 Urgentna medicina 70832 First Aid for the Basic Sciences: General Principles 1ed ISE 70833 First Aid for the Basic Sciences: Organ Systems 1ed ISE
Alan M Fein NJutn, Kristofer R. - autor 6LPHXQRYLь6ODYLFDDXWRU 5LVWLь,YDQ'DXWRU 5LVWLь,YDQ'DXWRU Aleksandar Pavlovic Mark B. Mengel, L. Peter Schwiebert Iii, C. William Hanson JANG Longmore, Murray; Wilkinson, Ian; Turmezei, Tom; C Bhangu, Aneel; Lee, Caroline; Porter, Keith 9XNXгLь=YRQLPLUDXWRU DQLь'DYRULQL6HNHOM Alan 0LURVODY6.RYDюHYLь LE LE
2006 17080.00 2007 1296.00 2007 864.00
2007 2008 2007 2009
680.00 1512.00 2106.00 4147.00
2009 12809.00 2008 1585.00 2008 4996.00
2009 2495.00 2009 540.00
2000 4410.00 2005 972.00 2009 2800.00 2009 2800.00
70893 Emergency Medicine: PreTest Self-Assessment & Review 2ed ISE
ROSH
2009 1574.00
71603 Essential Emergency Medicine, 71633 Saunders Nursing Survival Guide: Critical Care & Emergency Nursing , 71650 Paramedic Practice Today - 2-Volume Text, 2-Volume Workbook, and Virtual Patient Encounters Package Above and Beyond
Steven W. Salyer Lori Schumacher Aehlert
2009 4147.00 2009 3171.00 2009 23302.00
72258 Oxford Handbook of Emergency Nursing 72399 Neurotrauma and Critical Care of the Spine 72400 Neurotrauma and Critical Care of the Brain 72401 Decision Making in Neurocritical Care 73119 CLINICAL PRACTICE EMERGENCY MED 5E CB 73319 Case Files: Emergency Medicine, 2 Ed - ISE
Crouch OBE Jack Jallo, Alexander R. Vaccaro Jack Jallo, Christopher M. Loftus Frontera, Jennifer A. Frontera WOLFSON Toy
2009 2375.00 2008 14035.00 2009 19435.00 2009 5395.00 2009 18544.00 2009 1732.00
73516 CRITICAL CARE MEDICINE 4E - IE 74202 Oxford Handbook of Respiratory Medicine and Emergencies in Respiratory Medicine Pack 74204 Oxford Handbook of Cardiology and Emergencies in
MARINI Chapman, Steven; Robinson, Grace; Stradling, John; Ramrakha, Punit; Hill,
2009 4270.00 2009 5621.00 2009 5621.00 106 od 116
Cardiology Pack (2/e)
Jonathan; Myerson, Saul G.;
74698 Critical Care Ultrasonography
Alexander Levitov, Paul H. Mayo, Anthony D. Sloni
74725 Intensive Review for the Emergency Medicine
Sassan Naderi, Richard
Qualifying Examination (Intensive Review Book & CD Park
Rom)
74726 Pediatric Emergency Medicine: Third Edition (Strange, Gary R. Strange, William F
Pediatric Emergency Medicine)
Ahrens, Robert W. Schaf
76548 Rosen's Emergency Medicine, 7 Ed,Expert Consult John Marx Premium Edition ­ Enhanced Online Features and Print
80823 Neonatal and Infant Emergencies
Sharieff/Mccollough
81006 Oxford Handbook of General Practice and Emergencies in Primary Care Pack
Simon, Chantal; Everitt, Hazel; Van Dorp, Francois
82722 Rana
+DQюHYLь-DQNR$QWROMDN Tonisav i suradnici
83021 Minor Injuries,
Dennis Purcell
109420 Kardiopulmonalna cerebralna reanimacija
/DOHYLь3UHGUDJDXWRU
110398 2SьLLQVWUXNWRUVNLWHюDM
110826 +LWQDVWDQMDXQHXURKLUXUJLMLGLMDJQRVWLюNRWHUDSLMVNL 0LURVODY6DPDUGеLь YRGLю
111637 Emergency Medicine Review,
Richard A. Harrigan
111776 International Trauma Life Support:International Edition John Campbell 6ed
112135 First Aid 5e
Aaos
112281 First Aid for the Emergency Medicine Oral Boards (First David S Howes, Rohit
Aid Specialty Boards)
Gupta, Flora Waples-Trefil
112487 First Aid for the USMLE Step 3, Third Edition (First Aid Tao Le, Vikas Bhushan,
USMLE)
Robert W. Grow
112489 FIRST AID FOR THE USMLE STEP 1, 2010
LE
112717 Spine and Spinal Cord Trauma: Evidence-Based Management
113518 Dvd- First Aid 5e Dvd
114332 ESSENTIAL EMERGENCY TRAUMA
PB
114334 POCKET EMERGENCY MEDICINE 2E
SP
114336 TEXT PEDIATRIC EMERGENCY MEDICINE 6E CB
114592 Emergency Medicine Secrets,
114832 Practical Procedures in Anaesthesia and Critical Care
115362 Napredno odrzavanje zivota 116060 First Aid for the USMLE Step 2 CS
Jerome Ed. Vaccaro Aaos SHAH ZANE FLEISHER Vincent J. Markovchick Jackson, Guy; Soni, Neil; Whiten, Christopher J. LE
116129 AVOIDING COMMON ERRORS IN THE ED PB MARCUCCI
urologija
14583 Kidneys, Ureters and Urinary Bladder (Netter Collection Frank H. Netter of Medical Illustrations, Volume 6)
18846 Rekonstrukcijska uroloska kirurgija
Darko Kropfl
18868 8URORгNLLGLMDJQRVWLюNLDOJRULWPL
Marian Radej
29667 Drug Treatment in Urology
Eardley
30616 Oxford Handbook of Genitourinary Medicine, HIV and Pattman, Richard AIDS
32127 Urologija 1,2
0DUNRYLь9HOLERU
2009 15249.00 2009 6587.00
2009 11590.00 2009 29402.00
2008 6710.00 2010 5621.00
2000 5145.00
2010 2008 2010
4025.00 1620.00 1486.00 1620.00
2010 7807.00 2007 4281.00
2006 700.00 2010 9515.00
2010 4025.00
2010 2428.00
2010 19435.00
2006 2010 2010 2010 2010 2010
5710.00 5978.00 4264.00 17568.00 4025.00 4370.00
2009 2100.00 2010 2922.00
2010 4630.00
2000 6460.00
1999 2003 2005 2005
4480.00 3500.00 6039.00 2750.00
1997 2160.00 107 od 116
32127 Urologija 1,2
0DUNRYLь9HOLERU
36219 Campbells Urology 9 Ed- 4 vol IE
Wein
37822 UROLOSKA ONKOLOGIJA
5XяHU1RYDN$QWXQ7XFDNL suradnici
43537 The Overactive Bladder
Kreder Iii
43590 *sp* Smith's Textbook of Endourology,
Arthur Smith
43963 Genitourinary Imaging, 2nd edition
Ronald Zagoria
48915 Atlas of Urogynecological Endoscopy
48920 Male Sexual & Reproductive Dysfunction Pathophysiology and Treatm
Kandeel Fouad R
53596 SMITH'S GENERAL UROLOGY 17ed ISE
55997 Complications Urologic Surg Prac
Loughlin
59976 Early Diagnosis and Treatment of Cancer Series: Prostate Cancer,
Li-Ming Su
60009 Urogenital Imaging (Direct Diagnosis in Radiology: DX- Bernd Hamm, Dirk
Direct!)
Beyersdorff, Uta Lemke
60045 Ultrasonography in Urology: A Practical Approach to Edward I. Bluth, Philip W.
Clinical Problems
Ralls, Carol B. Benson
60763 Atlas of Laparoscopic Urologic Surgery (Atlas Of...)
Serdar Deger, Jan Roigas, Robert G. Moore
61063 Urological Surgery (Oxford Specialist Handbooks in Surgery)
Reynard, John; Turner, Kevin; Mark, Stephen; Armen
61721 Lokalizovani karcinom prostate
Jovan Hadzi-Djokic
62022 One Stop Doc: Renal System and Electrolyte Balance Panos Stamoulos
62075 Bolesti prostate
0DUNRYLь9HOLERUDXWRU
62177 Kamenci urinarnog trakta : etiopatogeneza, prevencija, -DQX]RYLь1RYLFD/-
OHюHQMH 8ULQDU\7UDFW6WRQHV
autor
65974 Urinarne derivacije
-RYDQ%+DGеLRNLь
66501 Oxford Handbook of Urology (2/e)- IE
Reynard, John; Brewster, Simon; Biers, Suzanne
68855 Male Fertility and Infertility
Glover/Barratt
69775 Urinarna inkontinencija
7LKRPLU59HMQRYLь-RYDQ %+DGеLRNLь
71821 Urodynamics Made Easy, 3rd Edition
Christopher R. Chapple
1997 2160.00 2006 32384.00 1994 3500.00
2007 2006 2006 2006 2007
15250.00 24235.00 4025.00 12078.00 35990.00
2008 4391.00 2007 18300.00 2009 10979.00
2008 4855.00
2007 7555.00
2007 10370.00
2008 5315.00
2005 2000 2007
2052.00 1341.00 1080.00 756.00
2009 2808.00 2009 2750.00
2009 3415.00 2009 2808.00
2009 3415.00
71824 Hinman's Atlas Of Pediatric Urologic Surgery, 2nd Edition
Frank Hinman
72481 Teaching Atlas of Urologic Imaging
Robert A. Older, Matthew Bassignani
73528 5 MINUTE UROLOGY CONSULT 2E
CB
GOMELIA
77447 Karcinom prostate
0DUNRYLь9HOLERU6DXWRU
79175 Urologija
9HOLERU60DUNRYь
110202 Oxford Handbook of Genitourinary Medicine, HIV, and Sankar, Nathan; Pattman,
Sexual Health
Richard; Handy, Pauline;
110396 Rak prostate
Mirko Samija i suradnici
115220 Dx/Rx: Sexual Dysfunction in Men and Women
Zaslau
115384 Stres inkontinencija urina
7DOLь%UDQLVODY
veterina
8339 9HWHULQDUVNLUHюQLN
Nevenka Bjelica
8398 *sp* Learning Veterinary Terminology, 2nd Edition
McBride
9515 *sp* The Little Book of Bees
Weiss
2008 25132.00
2009 12955.00
2009 2007 2009 2010
8052.00 1296.00 1944.00 3495.00
2010 2010 1995
5648.00 3171.00 50.00
2002 1620.00 2001 1450.00 2002 2263.00 108 od 116
18757 Laboratory Animal Medicine, 2nd edition
Fox Et Al
18830 %DNWHULMVNHLJOMLYLюQHEROHVWLеLYRWLQMD
&YHWQLь
18831 Zdravstvena dezinsekcija u nastambama i okolisu
Asaj Antur
18832 Deratizacija u praksi
Antun Asaj
18833 Dezinfekcija
Antur Asaj
18834 %MHVQRьD
6ODYNR&YHWQLь
18835 Veterinarska toksikologija
9MHNRVODY6UHERюDQ
18836 Pokusni modeli u biomedicini
0DUNR5DGRюLь
18892 Ekolosko higijenska polazista u saranskim ULEQMDюDUVWYLPD
Antun Asaj
18927 ,PHQLNLUMHюQLNIDXQHMDGUDQVNRJPRUD
0ODGHQ(UFHJRYLь
19611 $7/$67232*5$)6.($1$720,-('20$ы,+ ZIVOTINJA
Peter Popesko
19612 HIGIJENA NA FARMI I U OKOLISU
Antun Asaj
32555 *sp* Biology of Metabolism in Growing Animals
Burrin
34763 Saunders Comprehensive Veterinary Dictionary (Soft Douglas Blood Cover),
36169 Pathologic Basis of Veterinary Disease,
M. Donald Mcgavin
36211 Veterinary Genetics and Reproductive Physiology
Susan Long
36285 Veterinary Laser Surgery a Practical Guide
Berger
38969 Current Therapy in Large Animal Theriogenology, 2nd Robert Youngquist edition
41820 (.2/2в.2672э$56792,+20(23$7,-$
Antun Asaj
43917 Comparative Reproductive Biology
Schatten
43919 Differential Diagnosis in Small Animal Medicine
Gough A
44100 A Dictionary of Animal Behaviour
Mcfarland, David
45366 BSAVA Manual of Canine and Feline Clinical Pathology Second edition
Villiers E
46948 NACIONALNI REGISTAR VETERINARSKIH LEKOVA 2007
47758 Jubb, Kennedy & Palmer's Pathology of Domestic Animals,
M. Maxie
48328 Small Animal Medical Differential Diagnosis,
Mark Thompson
48388 Textbook of Veterinary Physiology,
James Cunningham
50901 Atlas of Small Animal Ultrasonography
Penninck D
52646 Textbook of Veterinary Diagnostic Radiology,
Donald E. Thrall
53880 Manual of Skin Diseases of the Dog and Cat
Paterson
55111 Small Animal Clinical Pharmacology,
Jill Maddison
55124 Veterinary Medical Terminology,
Dawn Christenson
55140 Veterinary Neuroanatomy and Clinical Neurology,
Alexander delahunta
55169 Large Animal Internal Medicine
Smith, Bradford
55170 Diagnostic Cytology and Hematology of the Dog and Rick Cowell Cat,
55801 Handbook of Small Animal Radiological Differential Diagnosis
56121 Saunders Solutions in Veterinary Practice: Small Animal Dermatology,
Anita Patel
56792 Veterinary Dental Techniques for the Small Animal Practitioner,
Steven Holmstrom
57930 Small Animal ECGs - An Introductory Guide 2e
Martin MWS
57948 Ophthalmology for the Veterinary Practitioner
Stades
59412 Small Animal Dentistry, A manual of techniques
Tutt C
2002 2002 1999 1999 2000 1999 1993 2000
21960.00 3500.00 1540.00 1148.00 1820.00 560.00 2030.00 2800.00 2800.00
2003 4200.00 2004 16800.00
2003 2800.00 2005 10248.00 2006 4757.00
2006 2006 2006 2006
10979.00 3049.00 7259.00 14640.00
2006 0 2007 2006 2005
2100.00 9150.00 3903.00 1374.00 10858.00
2007 1188.00
2007 31842.00
2007 2007 2008 2007 2008 2008 2008 2008 2009 2008
4269.00 8661.00 12199.00 9515.00 6465.00 7319.00 4757.00 9881.00 15860.00 10491.00
2001 5489.00
2008 5123.00
2004 8905.00
2007 3659.00 2007 9638.00 2006 7747.00 109 od 116
59412 Small Animal Dentistry, A manual of techniques
Tutt C
59413 Blackwell's Five-Minute Veterinary Consult Clinical Companion Small Animal Dentistry
Lobprise HB
59414 Small Animal Ophthalmology,4 Ed
Robert Peiffer
59566 *sp* Exotic Animal Care & Management
Judah Nuttall
59583 Veterinary Diagnostic Imaging: Birds, Exotic Pets, and Charles S. Farrow Wildlife(Veterinary Diagnostic Imaging)
59590 Manual of Exotic Pet Practice
Mark Mitchell, Thomas N. Tully
59894 Slatter's Fundamentals of Veterinary Ophthalmology David Maggs, Paul Miller, Ron Ofri
59918 Manual of Canine and Feline Cardiology,
Larry P. Tilley
59929 Small Animal Internal Medicine,4 Ed
Richard Nelson
59930 Georgis Parasitology for Veterinarians
Dwight D. Bowman
60008 Atlas of Dental Radiography in Dogs and Cats
Gregg A. DuPont, Linda J. DeBowes
61275 Clinical Biochemistry of Domestic Animals, 6 Ed
61674 Colour Atlas of Anatomy of Small Laboratory Animals, Popesko volume one
61675 Colour Atlas of Anatomy of Small Laboratory Animals, Popesko volume two
61720 Principi genetike
HOLь1LQRVODYDXWRU
63454 Small Animal Dermatology,
Peter Hill
63468 Medical History and Physical Examination in Companion animals, 2nd Edition
A. Rijnberk
64312 BSAVA Manual of Canine and Feline Nephrology and Elliott J Urology 2e
65268 Small Animal Anaesthesia and Analgesia
Carroll GL
66698 Ophthalmic Disease in Veterinary Medicine
Martin C
66880 Essentials of Veterinary Ophthalmology, 2e
Gelatt KN
67696 Canine Behavior,
Bonnie Beaver
67697 The Merck, Merial Manual for Pet Health,
Merck
67698 Kirk's Current Veterinary Therapy Xiv,
John Bonagura
68922 Equine Breeding Management and Artificial Insemination,
Juan Samper
68923 Equine Anesthesia,
William Muir
68927 Color Atlas of Diseases and Disorders of the Foal,
Siobhan Brid Mcauliffe
68928 Equine Exercise Physiology,
Kenneth Hinchcliff
68930 Color Atlas of Veterinary Anatomy, Volume 3, The Dog Stanley H. Done and Cat,
68933 Veterinary Immunology - Text and Veterinary Consult Ian Tizard Package,
68943 The Diversity of Fishes - Biology, Evolution, and Ecology 2e
Helfman G
68946 BSAVA Small Animal Formulary
Ramsey I
68947 Handbook of Veterinary Pharmacology
Hsu WH
68948 Equine Color Genetics 3e
Sponenberg DP
68950 The Equine Hospital Manual
Corley K
68951 Large Animal Neurology 2e
Mayhew J
68954 BSAVA Manual of Canine and Feline Dentistry
Tutt C
68955 Colour Handbook of Skin Diseases of the Cat and Dog, NUTTALL 2 Ed
68956 BSAVA Manual of Canine and Feline Thoracic Imaging Schwarz T
2006 7747.00 2007 6039.00
2008 2008 2008
5367.00 4830.00 8539.00
2008 7441.00
2007 9637.00
2008 2008 2008 2008
8661.00 14884.00 6709.00 8539.00
2008 20740.00 1992 18056.00
1992 18056.00
2004 2002 2008
1404.00 5977.00 8051.00
2007 8784.00
2008 2009 2008 2008 2008 2008 2008
4635.00 6094.00 6099.00 5123.00 1585.00 10613.00 9149.00
2008 2008 2007 2009
8905.00 11345.00 6099.00 9515.00
2008 7685.00
2009 6094.00
2008 2008 2009 2008 2008 2007 2009
7320.00 4635.00 4879.00 8539.00 9149.00 8418.00 4874.00
2008 9760.00 110 od 116
69018 Introduction to Veterinary Anatomy and Physiology Revision Aid Package, 69599 VETERINARSKA TOKSIKOLOGIJA drugo obnovljeno i dopunjeno izdanje 69616 HIGIJENA I BIOEKOLOGIJA U PERADARSTVU 69683 Veterinary Reproduction & Obstetrics, 69809 Small Animal Oncology, 70027 Canine and Feline Cytology: A Color Atlas and Interpretation Guide 70090 2SгWDNOLQLюNDGLMDJQRVWLNDNRGGRPDьLKSDSNDUD 70095 0RUIRORJLMDGRPDьLKеLYRWLQMD 70110 Black's Veterinary Dictionary 70622 3$5$=,76.(%2/(67,3$6$,0$э$.$
Sally Bowden 9MHNRVODY6UHERюDQ(PLO 6UHERюDQ 0DULMD9XюHPLOR David E. Noakes Susan M. North Rose E. Raskin 5DGRMLюLь%LOMDQDDXWRU L]GDYDю вLMDюNL1HVWRUDXWRU Edward Boden :,.(5+$86(5.87,э,ы
0 4513.00
2009 4200.00
2008 2009 2009 2009
2800.00 13176.00 8051.00 9881.00
2008 1296.00
1997 2005 2006
1944.00 4320.00 1920.00
71193 Guide to the Dissection of the Dog,7 Ed 71197 Exotic Animal Medicine, A Quick Reference Guide
Howard E. Evans Lance Jepson
71638 Feline Orthopedic Surgery and Musculoskeletal Disease, 71675 Veterinary Pharmacology and Therapeutics 9e 71812 Pascoe's Principles and Practice of Equine Dermatology, 2nd Edition
P. M. Montavon Papich M Derek C. Knottenbelt
71891 Zoonoses - 2nd Edition
Martin Shakespeare
72508 Mccurnin's Clinical Textbook for Veterinary Technicians Joanna M. Bassert - Textbook and Workbook Package,7 Ed
72918 Clinical Medicine of the Dog and Cat 2e
Schaer M
73938 *sp* Clinicopathologic Principles for Veterinary Medicine
Robinson/Huxtable
74822 Small Animal Gastroenterology
Steiner J
74868 Introduction to Horse Nutrition
Davies Z
74869 Infectious Disease Management in Animal Shelters Miller L
74872 Practical Small Animal MRI
Gavin P
74874 A Colour Handbook of Urinary Stones in Small Animal Medicine
Hesse A
74875 Manual of Small Animal Soft Tissue Surgery
Tobias K
74876 Small Animal Medical Diagnosis, 3 Ed
Lorenz M
74877 BSAVA Manual of Canine and Feline Abdominal Imaging
O'Brien R
74879 BSAVA Manual of Canine and Feline Behavioural Medicine
Horwitz D
74884 Color Atlas of Small Animal Anatomy - The Essentials
McCracken T
74886 Veterinary Hematology: Atlas of Common Domestic and Non-Domestic Species, 2 Ed
Reagan WJ
76803 Clinical Canine and Feline Reproduction
Root Kustritz MV
76804 Gastrointestinal Nematodes of Sheep and Cattle Biology and Control
Sutherland I
76806 BSAVA Manual of Canine and Feline Musculoskeletal Houlton J Disorders
76807 BSAVA Manual of Canine and Feline Musculoskeletal Barr Imaging
2009 5367.00 2009 6343.00 2009 9271.00 2009 14030.00 2009 11345.00
2009 5123.00 2009 6709.00 2009 10370.00 2003 2440.00
2008 2009 2009 2009 2009
12078.00 3049.00 4879.00 10675.00 4264.00
2009 2009 2009
6465.00 4879.00 8540.00
2010 9028.00
2009 3903.00
2008 4269.00
2009 5855.00 2009 7929.00
2006 9760.00
2006 8540.00
111 od 116
76811 BSAVA Manual of Canine and Feline Emergency and King L Critical Care 2e
76812 Rickettsiology and Rickettsial Diseases - Fifth International Conference
Hechemy KE
76813 Functional Anatomy and Physiology of Domestic Animals 4e
Reece W
78752 Sloughi: A Comprehensive Owner's Guide (Kennel Club Books)
M. Crappon de Caprona
79508 Textbook of Veterinary Anatomy,
K. M. Dyce
79718 Saunders Veterinary Anatomy Flash Cards,
Saunders
81015 Veterinarska anesteziologija
'UDJDQ9XюRYLь
81176 %2/(67,352%$912*$6867$9$3$6$,0$э$.$ 'DOLERU3RWRюQMDN'DPLU Stanin, Nenad Turk
81177 VETERINARSKA KIRURGIJA I ANESTEZIOLOGIJA 'UDеHQ0DWLюLь'UDеHQ Vnuk
82719 $QDWRPLMDGRPDьLKVLVDYDFDXGеEHQLNLDWODV
Kцnig, H.E., Liebich, H-G., (ur.) Ur.hrv.izd. Mlad
82763 Color Atlas of Veterinary Anatomy, Volume 1, The Ruminants,
Raymond R. Ashdown
83027 Saunders Solutions in Veterinary Practice: Small Animal Neurology,
Sue Fitzmaurice
83068 Handbook of Small Animal Radiology and Ultrasound, Ruth Dennis
109183 Handbook of Small Animal MRI
Elliott I
109184 Saunders Solutions in Veterinary Practice: Small Animal Oncology,
Rob D. Foale
109185 AVTA's Anesthesia Manual for Veterinary Technicians
Bryant S
109186 Veterinary Anaesthesia - Principles to Practice
Dugdale A
109188 Feline Dentistry
Bellows J
109339 Laboratory Animal Anaesthesia,
Paul Flecknell
110485 Improving animal welfare: A Practical Approach (Cabi) T Grandin
110695 Dogs: Domestication and the Development of a Social Morey Bond
110815 Bolesti svinja
Samanc, Horea A. - autor L]GDYDю
110816 Bolesti organa za varenje goveda
Samanc, Horea A. - autor L]GDYDю
111157 The Merck Veterinary Manual, 10th Edition
Kahn CM
111589 Equine Dentistry,
Jack Easley
111594 Diagnostic Radiology and Ultrasonography of the Dog J. Kevin Kealy and Cat,
111616 Saunders Handbook of Veterinary Drugs,3ed
Mark G. Papich
111634 Atlas of Normal Radiographic Anatomy and Anatomic Donald E. Thrall Variants in the Dog and Cat,
111882 Canine and Feline Nephrology and Urology,2ed
Dennis J. Chew
111883 Saunders Solutions in Veterinary Practice: Exotics, Lesa Longley
111884 Saunders Solutions in Veterinary Practice: Small Animal Emergency Medicine,
Shailen Jasani
111885 Canine and Feline Nutrition,3ed
Linda P. Case
111886 Small Animal Pediatrics,
Michael E. Peterson
111887 Small Animal Dermatology,3ed
Keith A. Hnilica
113126 Bolesti respiratornog i kardio-vaskularnog sistema goveda
Samanc, Horea A. - autor L]GDYDю
2007 10370.00
2009 8540.00
2009 4269.00
2004 2456.00
2009 2009 2009 2010
9515.00 2927.00 2160.00 2660.00
2010 6300.00
2009 23520.00
2010 7319.00
2010 5367.00
2010 2010 2010
5489.00 3659.00 4879.00
2010 5001.00
2010 2010 2009 2009 2010
4879.00 7319.00 9394.00 5605.00 3050.00
2009 1728.00
2009 1188.00
2010 4508.00 2010 12199.00 2010 11833.00
2010 5855.00 2010 14884.00
2010 2010 2010
7197.00 5367.00 5367.00
2010 2010 2011 2010
5855.00 7197.00 10247.00 1188.00
112 od 116
113426 Advances in Veterinary Surgery - The Canine Cranial Cruciate Ligament
Muir P
113427 Behavior of Exotic Pets
Tynes VV
113429 Notes on Small Animal Dermatology
Joyce J
113695 BSAVA Manual of Canine and Feline
Fuentes VL
Cardiorespiratory Medicine 2e
113696 BSAVA Manual of Practical Animal Care
Hotston-Moore P
113701 BSAVA Guide to Procedures in Small Animal Practice Bexfield N Pracice
114103 Clinical Pathology for the Veterinary Team
Rosenfeld A
114104 Clinical Cases in Avian and Exotic Animal Hematology and Cytology
Campbell TW
114106 Small Animal Emergency and Critical Care Case Studies in Client Communication, Morbidity and Mortality
Powell L
114107 Blackwell's Five-Minute Veterinary Consult Clinical Companion - Small Animal Emergency and Critical Care
Mazzaferro EM
114109 Feline Emergency and Critical Care Medicine
Drobatz KJ
114110 Feline Patient 4e
Norsworthy G
114111 Blackwell's Five-Minute Veterinary Consult Clinical Companion: Small Animal Toxicology
Osweiler G
114113 Blackwell's Five-Minute Veterinary Consult Clinical Companion: Small Animal Dermatology with CD
Helton Rhodes K
114114 Home-Prepared Dog and Cat Diets 2e
Schenck P
114115 Clinical Canine and Feline Respiratory Medicine
Johnson LR
114119 Fundamentals of Small Animal Surgery
Mann F
114482 Anesthesia and Analgesia for Veterinary Technicians, John Thomas
114497 Veterinary Instruments and Equipment,
Teresa F. Sonsthagen
114708 VETERINARY IMMUNOLOGY - PRINCIPLES & PB DAY & SCHULTZ
114727 CARDIOVASC DISEASE SMALL ANIMAL MED PB WARE
114929 BSAVA Manual of Canine and Feline Rehabilitative, Palliative and supportive care
Watson P
115197 %2/(67,37,&$.8ы1,+/-8%,0$&$
(VWHOOD3UXNQHU5DGRYюLь
115361 Antimikrobna terapija u veterinarskoj medicini
116494 Clinical Veterinary Advisor,
Etienne Cote
116495 Veterinarska fiziologija
6WRMLь9HOLERU
zdravstvena nega
26251 Potter & Perry's Fundamentals of Nursing - Australian Crisp & Taylor Version, 2nd edition
36165 Mosby's Pocket Guide for Health Assessment, 6th edition
Pamela Weilitz
36507 Oxford Handbook of Pre-hospital Care
Greaves, Ian
40685 *sp* Leadership Roles and Management Functions in MARQUIS Nursing
43992 Watson's Clinical Nursing and Related Sciences ISE Walsh 6E
44004 MEDICAL SURGICAL NURSING 7E IE
Lewis
2010 9515.00 2010 5733.00 2010 4879.00 2010 10370.00 2007 5978.00 2010 9150.00 2010 4269.00 2010 9515.00 2010 4269.00
2010 7319.00
2010 6831.00 2010 10369.00 2010 7319.00 2011 7319.00
2010 2010 2011 2010 2010 2010 2010 2010
3781.00 6831.00 4819.00 4269.00 3293.00 3654.00 6094.00 9760.00
2010 2010 2011 2010
3500.00 2100.00 7929.00 1620.00
2005 6343.00 2006 3171.00 2006 2750.00 2005 1500.00 2007 2458.00 2007 4371.00 113 od 116
47398 Nursing Research: Generating and Assessing Evidence for Nursing Practice (Nursing Research (Polit))
Denise F. Polit; Cheryl Tatano Beck
47404 Lippincott's Textbook for Nursing Assistants: A Humanistic Approach to Caregiving
Pamela J. Carter
47405 Lippincott's Workbook for Nursing Assistants: A Humanistic Approach to Caregiving
Pamela J. Carter
47410 Irwin and Rippe's Intensive Care Medicine (Intensive Richard S. Irwin, James M.
Care Medicine (Irwin & Rippe's))
Rippe
47441 Wound Care Essentials: Practice Principles
Sharon Baranoski, Elizabeth A. Ayello
48324 Medical Devices: Use and Safety
Bertil Jacobson
48340 Differential Diagnosis for Primary Care,
Jennifer Jamison
48352 Lippincott's Q and A Review for NCLEX-RN (Lippincott's Review)
Diane McGovern Billings
52031 Pain Management: Evidence, Outcomes, and Quality of HarriЩt Wittink Life, A Sourcebook
53185 *sp* Soins infirmiers et douleur
Christiane Metzger, Christiane Walter, Andrй Mulle
54072 *sp* Contexts of Nursing 2e
Daly et al
59051 The Little ICU Book of Facts and Formulas
MARINO
59163 ATLAS MEDICATION ADMINISTRATION 2E
LWW
59914 Intensive Care: An Illustrated Colour Text
Michael Avidan, Kara M. Barnett, Laureen L. Hill
59935 Oh's Intensive Care Manual
Bersten , Soni
61049 Oxford Handbook of Palliative Care (2/e)-IE
Watson, Max; Lucas, Caroline; Hoy, Andrew; Wells,
61375 CURRENT CRITICAL CARE DIAGNOSIS AND TREATMENT, 3 ed ISE
BONGARD
62062 Student Nurses' Guide to professional practice and Development
Jane E Schober
65816 Sestrinske procedure
Springhouse
66486 Oxford Handbook of Clinical Skills in Adult Nursing
Randle, Jacqueline; Coffey, Frank; Bradbury, Marty
67662 Oxford Handbook of Clinical Rehabilitation (2/e)
Ward, Anthony; Barnes, Michael; Stark, Sandra; Rya
67760 Zdravstvena nega i savremeno sestrinstvo
0LOHQD7LMDQLь'HVDQND XUDQRYLь5DWRPLUND5XGLь
68525 Oxford Handbook of Cancer Nursing
Tadman, Mike; Roberts, Dave
68527 Oxford Handbook of Women's Health Nursing, 1 Ed
Gupta, Sunanda; Holloway, Debra; Kubba, Ali
69439 Oxford Textbook of Palliative Medicine (4/e)
Hanks, Geoffrey; Cherny, Nathan I.; Christakis, Ni
71307 Bailliere's Nurses Dictionary 25e IE
Weller
2007 3843.00
2007 2989.00
2007 1647.00
2007 15738.00
2007 3044.00
2006 0 2007
3415.00 4757.00 2745.00
2007 6709.00
2007 400.00
2005 2008 2006 2007
1250.00 3044.00 970.00 3415.00
2008 8051.00 2009 2750.00
2008 3537.00 2005 2073.00 2010 1980.00 2009 2250.00 2009 3495.00 2008 2160.00 2007 2375.00 2009 2375.00 2009 20633.00 2009 818.00
71628 Simulation Learning System for Ignatavicius and Workman: Medical-Surgical Nursing 6 Ed 71629 Essential Decision Making and Clinical Judgement for Nurses, 71654 Virtual Patient Encounters for Paramedic Practice Today, 71862 Nursing Knowledge and Practice, 3rd Edition
Ignatavicius, Howard, Schumacher & Weberg Carl Thompson Barbara Aehlert Maggie Mallik
2009 7197.00 2009 3171.00 2009 4269.00 2009 3659.00 114 od 116
71869 Notes on Nursing- A Guide for Today's Caregivers
International Council of
72226 Oxford Handbook of Respiratory Nursing
Robinson
72250 Oxford Handbook of Nurse Prescribing
Beckwith
72253 Oxford Handbook of Primary Care and Community Nursing
Drennan
72311 Oxford Handbook of Gastrointestinal Nursing
Norton
72347 Oxford Handbook of Nursing Older People
Tabernacle
72354 Oxford Handbook of Children's and Young People's Nursing
Glasper
72400 Neurotrauma and Critical Care of the Brain
Jack Jallo, Christopher M. Loftus
72617 Oxford Handbook of Adult Nursing, 1 Ed
Castledine, George; Close, Ann
72618 Oxford Handbook of Learning and Intellectual Disability Gates, Bob; Barr, Owen Nursing, 1 Ed
72619 Oxford Handbook of Diabetes Nursing, 1 ed
Avery, Lorraine; Beckwith, Sue
72620 Oxford Handbook of Neuroscience Nursing, 1 Ed
Woodward, Sue; Waterhouse, Catheryne
72621 Oxford Handbook of Critical Care Nursing, 1 Ed
Adam, Sheila K; Osborne, Sue
73097 MANUAL INTENSIVE CARE MEDICINE 5E PB
IRWIN
73134 Fluids and Electrolytes: An Incredibly Easy! Pocket Guide, 2 Ed
LWW
73616 Brunner and Suddarth's Textbook of Medical-Surgical SMELTZER Nursing, 12e IE ED CB
74366 Oxford Handbook of Musculoskeletal Nursing
Oliver, Susan
74719 Lippincott Manual of Nursing Practice, 9 Ed - IE
NETTINA
74730 CURRENT Practice Guidelines in Primary Care 2009 Ralph Gonzales, Jean S.
(Lange Current Series)
Kutner
79217 Churchill's Pocketbook of Intensive Care, 3rd Edition Simon M. Whiteley
81006 Oxford Handbook of General Practice and Emergencies in Primary Care Pack 82314 Critical Care Nursing Made Incredibly Easy! (1st UK Edition) 82374 Proces zdravstvene nege : praktikum za studente YRGLю]DSUDNVX 108731 Cambridge English for Nursing Intermediate Plus Student's Book with Audio CDs (2) 112135 First Aid 5e 112136 Clinical Handbook for Medical-Surgical Nursing 112640 ESSENTIALS NURSING RESEARCH 7E IE VER PB 112641 FUNDAMENTALS OF NURSING 7E (INT ED) CB 112643 TEXT MED SURG NURS 12E H/BK (INT ED) PB 112657 Practical Guide to the Care of the Medical Patient, 8th Edition Expert Consult: Online and Print 113400 Leadership and Management in Nursing 115078 Oxford Handbook of Critical Care and Emergencies in Critical Care Pack (2/e)
Simon, Chantal; Everitt, Hazel; Van Dorp, Francois CUTLER 5XGLь5DWRPLUNDDXWRU Virginia Allum, Patricia McGarr Aaos Kathleen Osborn Charlotte Miller Annita Watson Che POLIT TAYLOR SMELTZER Fred F. Ferri Mary Grohar-Murray Singer, Mervyn; Webb, Andrew
2009 1219.00
2009 2007 2007
2375.00 2375.00 2375.00
2008 2009 2006
2375.00 2375.00 2375.00
2009 19435.00
2009 2495.00
2009 2495.00
2009 2375.00
2009 2870.00
2009 2870.00
2009 4270.00 2009 2434.00
2009 4879.00
2009 2009 2009
2870.00 4874.00 1219.00
2010 3049.00
2010 5621.00
2010 3044.00
2008 1080.00
2008 1160.00
2006 700.00 2010 1536.00
2009 2010 2010 2010
3044.00 4270.00 3233.00 4025.00
2010 2964.00 2009 5621.00 115 od 116
115088 Skills of Clinical Supervision for Nurses: A Practical Guide for Supervisees, Clinical Supervisors and Managers
Meg Bond, Stevie Holland
115090 The Nurse Mentor's Handbook: Supporting Students in Danny Walsh Clinical Practice
115359 32732512,3$/,-$7,912/,-(э(1-( ONKOLOSKIH BOLESNIKA
M. Samija, D. Nemet i suradnici
116050 Drugs in Palliative Care
Dickman, Andrew
118357 Core Topics in Airway Management
Calder/Pearce
118480 .URQLюQDUDQD±GHNXELWXVLXOFXVFUXULV
+DQюHYLь-LVXU
118526 Medical Surgical Nursing Single Vol 8ed
Lewis
Sve detaljnije informacije mozete da dobijete na: http://www.datastatus.rs [email protected] tel 0800 300 033, fax: 011 3017 835
2010 2927.00
2010 2439.00
2010 6160.00
2010 2010 2010 2011
3120.00 6710.00 1764.00 4147.00
116 od 116

M Frotscher, W Kahle, M Frotscher, W Platzer

File: cenovnik-medicina.pdf
Title: Cenovnik
Author: M Frotscher, W Kahle, M Frotscher, W Platzer
Published: Wed Apr 27 07:14:34 2011
Pages: 116
File size: 0.59 Mb


Energy star, 19 pages, 1.45 Mb

, pages, 0 Mb
Copyright © 2018 doc.uments.com